Use Able AI chat for product recommendations

CLRN1 Polyclonal antibody

CLRN1 Polyclonal Antibody for WB, IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

clarin 1, CLRN1, USH3, USH3A, Usher syndrome type 3 protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CLRN1 in ?

Tested Applications

Positive WB detected inHeLa cells
Positive IHC detected inmouse testis tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26630-1-AP targets CLRN1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24289

Product name: Recombinant human CLRN1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 156-232 aa of BC074970

Sequence: ASEVKIHHLSEKIANYKEGTYVYKTQSEKYTTSFWVIFFCFFVHFLNGLLIRLAGFQFPFAKSKDAETTNVAADLMY

Predict reactive species
Full Name clarin 1
Calculated Molecular Weight 232 aa, 26 kDa
Observed Molecular Weight 23 kDa, 27 kDa
GenBank Accession NumberBC074970
Gene Symbol CLRN1
Gene ID (NCBI) 7401
RRIDAB_2880579
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP58418
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for CLRN1 antibody 26630-1-APDownload protocol
WB protocol for CLRN1 antibody 26630-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The CLRN1 Polyclonal antibody (Cat# 26630-1-AP) has 2 total citations. These appear in Investigative Ophthalmology & Visual Science and Journal of Pathol. The research fields covered include Usher syndrome, Müller glia biology, and photoreceptor degeneration in the retina.

SpeciesApplicationTitle

Invest Ophthalmol Vis Sci

Müller Glia-Exclusive CLRN1 Expression Drives Non-Cell-Autonomous Photoreceptor Degeneration in Usher Syndrome Type 3A.

Authors - Yeachan Lee
human,mouseWB

J Pathol

Clarin-1 expression in adult mouse and human retina highlights a role of Müller glia in Usher syndrome.

Authors - Lei Xu

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer (Sunny S.) gave a 5-star rating, reporting successful use of this antibody in Western Blot at a 1:6000 dilution. The antibody effectively captured full-length Clarin-1 protein produced via an ALiCE cell-free expression system, serving as a reliable confirmation of the expressed protein following SDS-PAGE analysis.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Sunny (Verified Customer) (10-02-2025)

The antibody helped capture the full length Clarin-1 protein which was produced in our lab using the cell free expression system of ALiCE. This was a good confirmation of the produced protein after we saw the SDS- PAGE band.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:6000
Loading...
||
New chat

Able™

正在加载,请稍候...