Use Able AI chat for product recommendations

Collagen Type I Polyclonal antibody

The Collagen Type I polyclonal antibody (14695-1-AP) is one of the most highly cited Collagen Type I antibodies in the market. It is suitable for WB, IHC, IP, ELISA and has been referenced in over 1,664 publications.

Cat No. 14695-1-AP
Publications(1664)

Host / Isotype

Rabbit / IgG

Reactivity

human, pig and More (7)

Applications

WB, IHC, IF, FC (Intra), IP, CoIP, ELISA, Western Blot

COL1, COL1A2, Alpha-2 type I collagen, col I, Collagen alpha 2(I) chain

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU-87 MG cells, human placenta tissue, MG-63 cells, pig skin tissue, Saos-2 cells
Positive IP detected inU-87 MG cells
Positive IHC detected inhuman colon tissue, human breast cancer tissue, human oesophagus cancer tissue, human placenta tissue, human skin cancer tissue, human stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14695-1-AP targets Collagen Type I in WB, IHC, IF, FC (Intra), IP, CoIP, ELISA, Western Blot applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Cited Reactivityhuman, mouse, rat, pig, rabbit, chicken, hamster, sheep, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6281

Product name: Recombinant human COL1A2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1017-1366 aa of BC054498

Sequence: RGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK

Predict reactive species
Full Name collagen, type I, alpha 2
Calculated Molecular Weight 1366 aa, 130 kDa
Observed Molecular Weight130-160 kDa
GenBank Accession NumberBC054498
Gene Symbol COL1A2
Gene ID (NCBI) 1278
RRIDAB_2082037
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP08123
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Type I collagen, the major structural component of connective tissues such as skin, tendon and bone, is the most abundant and widely expressed collagen in humans (PMID: 7620364; 8645190; 9016532). Type I collagen is a heterotrimer comprising one alpha 2(I) and two alpha 1(I) chains which are encoded by the unlinked loci COL1A2 and COL1A1 respectively. Mutations in COL1A2 gene are associated with osteogenesis imperfecta, Ehlers-Danlos syndrome, idiopathic osteoporosis, and atypical Marfan syndrome. This antibody raised against 1017-1366 aa of human pro-alpha 2 chain of type l collagen can recognize collagen alpha 2(1) chain and C-terminal propeptide of pro-alpha 2(1) chain.

Protocols

Product Specific Protocols
IHC protocol for Collagen Type I antibody 14695-1-APDownload protocol
IP protocol for Collagen Type I antibody 14695-1-APDownload protocol
WB protocol for Collagen Type I antibody 14695-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
rat,mouseWB,IF

Signal Transduct Target Ther

2-APQC, a small-molecule activator of Sirtuin-3 (SIRT3), alleviates myocardial hypertrophy and fibrosis by regulating mitochondrial homeostasis

Authors - Fu Peng
mouse,humanWB

Signal Transduct Target Ther

Overexpression of STX11 alleviates pulmonary fibrosis by inhibiting fibroblast activation via the PI3K/AKT/mTOR pathway

Authors - Guichuan Huang
humanIF

Cancer Cell

Single-cell multi-stage spatial evolutional map of esophageal carcinogenesis

Authors - Jiang Chang
mouseIF

Nature

Cartilage-like protein hydrogels engineered via entanglement

Authors - Linglan Fu
mouseWB

Gastroenterology

Pancreatic acinar cells-derived sphingosine-1-phosphate contributes to fibrosis of chronic pancreatitis via inducing autophagy and activation of pancreatic stellate cells

Authors - Decai Wang
humanIF

Adv Mater

Self-Growing Scaffold for Spatial and Border Expansive Regeneration

Authors - Liheng Gao

Reviews

    4.6 out of 5
Add a review

10 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


John (Verified Customer) (01-30-2026)

Good collagen antibody for IF. Strong signal. Worked well with calcium phosphate cement cultured cells (MC3T3-E1).

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:400
  • Cell Tissue Type: MC3T3-E1 pre-osteoblast
Collagen Type I Antibody Immunofluorescence validation (1:400 dilution) in MC3T3-E1 pre-osteoblast (Cat no:14695-1-AP)

p (Verified Customer) (09-23-2024)

Excellent

  • Applications: Western Blot
  • Primary Antibody Dilution: 1000
  • Cell Tissue Type: HEK
Collagen Type I Antibody Western Blot validation (1000 dilution) in HEK (Cat no:14695-1-AP)

Brice-Emmanuel (Verified Customer) (10-12-2023)

I have 2 bands in 70 kDa

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: Mouse Heart Tissue
Collagen Type I Antibody Western Blot validation (1/1000 dilution) in Mouse Heart Tissue (Cat no:14695-1-AP)

S (Verified Customer) (03-20-2023)

Excellent Antibody!

  • Applications: Western Blot
  • Primary Antibody Dilution: 1000
  • Cell Tissue Type: fibroblast
Collagen Type I Antibody Western Blot validation (1000 dilution) in fibroblast (Cat no:14695-1-AP)

Balawant Kumar (Verified Customer) (12-20-2022)

antibody is working great. I have used this antibody for mice colon tissue and colon cancer cell line

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: colon tissue and colon cancer cell line (caco2, HCT116)

PK (Verified Customer) (07-08-2022)

Very Good

  • Applications: Western Blot
  • Cell Tissue Type: Fibroblast
Collagen Type I Antibody Western Blot validation ( dilution) in Fibroblast (Cat no:14695-1-AP)

Ren Jie (Verified Customer) (06-22-2022)

Very strong signal for collagen I, needs stringent wash conditions to minimize ladder staining in western blot

  • Applications: Western Blot, Other
  • Primary Antibody Dilution: 1:1000

S (Verified Customer) (12-01-2021)

Excellent

  • Applications: Western Blot
  • Cell Tissue Type: LUNG FIBROBLASTS
Collagen Type I Antibody Western Blot validation ( dilution) in LUNG FIBROBLASTS (Cat no:14695-1-AP)

Hala (Verified Customer) (02-23-2021)

very good

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000

Eistine (Verified Customer) (05-31-2019)

The antibody works pretty good

  • Applications: Immunofluorescence,
Loading...
||
New chat

Able™

正在加载,请稍候...