Mu Crystallin Polyclonal antibody

Mu Crystallin Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA
Cat No. 12495-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

CRYM, crystallin, mu, DFNA40, EC:1.5.1.25, Ketimine reductase mu-crystallin

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inY79 cells, Jurkat cells, human kidney tissue, human heart tissue
Positive IHC detected inhuman gliomas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman gliomas tissue
Positive IF/ICC detected inSH-SY5Y cells
Positive FC (Intra) detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12495-1-AP targets Mu Crystallin in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3161

Product name: Recombinant human CRYM protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-314 aa of BC018061

Sequence: MSRVPAFLSAAEVEEHLRSSSLLIPPLETALANFSSGPEGGVMQPVRTVVPVTKHRGYLGVMPAYSAAEDALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRTAAVSAIATKFLKPPSSEVLCILGAGVQAYSHYEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVIITVTLATEPILFGEWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK

Predict reactive species
Full Name crystallin, mu
Calculated Molecular Weight 314 aa, 34 kDa
Observed Molecular Weight 34 kDa
GenBank Accession NumberBC018061
Gene Symbol Mu Crystallin
Gene ID (NCBI) 1428
RRIDAB_2084620
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ14894
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

mu Crystallin(thiomorpholine-carboxylate dehydrogenase) is also named as THBP, CRYM, ketimine reductase and belongs to the ornithine cyclodeaminase family. This protein catalyzes the reduction of imine bonds in brain substrates that may include cystathionine ketimine (CysK) and lanthionine ketimine (LK). It is also involved in the regulation of the free intracellular concentration of triiodothyronine and access to its nuclear receptor.

Protocols

Product Specific Protocols
IF protocol for Mu Crystallin antibody 12495-1-APDownload protocol
IHC protocol for Mu Crystallin antibody 12495-1-APDownload protocol
WB protocol for Mu Crystallin antibody 12495-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Dev Cell

Single-Cell Transcriptomic Analyses of the Developing Meninges Reveal Meningeal Fibroblast Diversity and Function.

Authors - John DeSisto
ratWB

Endocr J

Follicular thyroglobulin enhances gene expression necessary for thyroid hormone secretion.

Authors - Yuko Ishido
ratWB,IHC,IF

Neuropathology

Expression of CRYM in different rat organs during development and its decreased expression in degenerating pyramidal tracts in amyotrophic lateral sclerosis.

Authors - Reiji Hommyo
Loading...
||
New chat Able
正在加载,请稍候...