CoraLite®594-conjugated Mu Crystallin Polyclonal antibody

Mu Crystallin Polyclonal Antibody for IF-P, FC (Intra)
Cat No. CL594-12495

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P, FC (Intra)

CRYM, crystallin, mu, DFNA40, EC:1.5.1.25, Ketimine reductase mu-crystallin

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman gliomas tissue
Positive FC (Intra) detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

CL594-12495 targets Mu Crystallin in IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3161

Product name: Recombinant human CRYM protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-314 aa of BC018061

Sequence: MSRVPAFLSAAEVEEHLRSSSLLIPPLETALANFSSGPEGGVMQPVRTVVPVTKHRGYLGVMPAYSAAEDALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRTAAVSAIATKFLKPPSSEVLCILGAGVQAYSHYEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVIITVTLATEPILFGEWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK

Predict reactive species
Full Name crystallin, mu
Calculated Molecular Weight 314 aa, 34 kDa
Observed Molecular Weight 34 kDa
GenBank Accession NumberBC018061
Gene Symbol Mu Crystallin
Gene ID (NCBI) 1428
RRIDAB_2919784
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ14894
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

mu Crystallin(thiomorpholine-carboxylate dehydrogenase) is also named as THBP, CRYM, ketimine reductase and belongs to the ornithine cyclodeaminase family. This protein catalyzes the reduction of imine bonds in brain substrates that may include cystathionine ketimine (CysK) and lanthionine ketimine (LK). It is also involved in the regulation of the free intracellular concentration of triiodothyronine and access to its nuclear receptor.

Protocols

Product Specific Protocols
FC protocol for CL594 Mu Crystallin antibody CL594-12495Download protocol
IF protocol for CL594 Mu Crystallin antibody CL594-12495Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
IF

Cell Stem Cell

SYF2 suppression mitigates neurodegeneration in models of diverse forms of ALS

Authors - Gabriel R Linares
Loading...
||
New chat Able
正在加载,请稍候...