Tested Applications
| Positive WB detected in | PC-3 cells, MCF-7 cells |
| Positive IP detected in | PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26913-1-AP targets CSGALNACT1 in WB, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25455 Product name: Recombinant human CSGALNACT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 89-149 aa of BC060772 Sequence: RSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQVDKAEVNAGVKLATEYAAVPFD Predict reactive species |
| Full Name | chondroitin sulfate N-acetylgalactosaminyltransferase 1 |
| Calculated Molecular Weight | 61 kDa |
| Observed Molecular Weight | 61-68 kDa |
| GenBank Accession Number | BC060772 |
| Gene Symbol | CSGALNACT1 |
| Gene ID (NCBI) | 55790 |
| RRID | AB_2880682 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8TDX6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CSGalNAcT-1 (chondroitin sulfate N-acetylgalactosaminyltransferase-1), catalyzing the transfer of a GalNAc residue onto the nonreducing end of GlcA, is a key glycosyltransferase for chondroitin sulfate (CS) biosynthesis in cartilage. Abnormal expression of CSGalNAcT-1 in cartilage has been linked to diseases like osteoarthritis.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for CSGALNACT1 antibody 26913-1-AP | Download protocol |
| WB protocol for CSGALNACT1 antibody 26913-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CSGALNACT1 Polyclonal antibody (Cat# 26913-1-AP) has 2 total citations. These appear in British Journal of Pharmacology and Methods in Molecular Biology. The cited research spans neuropharmacology—specifically chondroitin sulfate proteoglycan's role in adult neurogenesis and cognitive function—and microbiology, focusing on bacterial amyloids. Both citations used the antibody for Western blot applications.
| Species | Application | Title |
|---|---|---|
Br J Pharmacol Chondroitin sulfate proteoglycan is a potential target of memantine to improve cognitive function via the promotion of adult neurogenesis. | ||
