Filter:
Product Information
82914-1-RR targets CTNNBIP1 in ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag13160 Product name: Recombinant human CTNNBIP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-81 aa of BC014300 Sequence: MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ Predict reactive species |
| Full Name | catenin, beta interacting protein 1 |
| Calculated Molecular Weight | 21 kDa |
| GenBank Accession Number | BC014300 |
| Gene Symbol | CTNNBIP1 |
| Gene ID (NCBI) | 56998 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NSA3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
