Tested Applications
| Positive WB detected in | PMA, LPS and Brefeldin A treated THP-1 cells |
| Positive IHC detected in | human intrahepatic cholangiocarcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | PMA, LPS and Brefeldin A treated THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27095-1-AP targets CXCL8/IL-8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25640 Product name: Recombinant human CXCL8/IL-8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 40-99 aa of BC013615 Sequence: YSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS Predict reactive species |
| Full Name | interleukin 8 |
| Calculated Molecular Weight | 99 aa, 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC013615 |
| Gene Symbol | IL-8 |
| Gene ID (NCBI) | 3576 |
| ENSEMBL Gene ID | ENSG00000169429 |
| RRID | AB_2861340 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P10145 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Interleukin 8 (IL-8), also known as CXCL8, which is a member of the CXC chemokine family. This chemokine is secreted by a variety of cell types including monocyte/macrophages, T cells, neutrophils, fibroblasts, endothelial cells, and various tumor cell lines in response to inflammatory stimuli. IL-8 has two primary functions. It induces chemotaxis in target cells, primarily neutrophils but also other granulocytes, causing them to migrate toward the site of infection. IL-8 also induces phagocytosis once they have arrived. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. IL-8 is also known to be a potent promoter of angiogenesis. IL-8 has been associated with tumor angiogenesis, metastasis, and poor prognosis in breast cancer. IL-8 may present a novel therapeutic target for estrogen driven breast carcinogenesis and tumor progression. The human IL-8 cDNA sequence predicts a protein of 99 amino acids. Removal of a 22-residue signal peptide generates a mature protein of 77 amino acids (~ 8 kDa).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CXCL8/IL-8 antibody 27095-1-AP | Download protocol |
| IHC protocol for CXCL8/IL-8 antibody 27095-1-AP | Download protocol |
| WB protocol for CXCL8/IL-8 antibody 27095-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CXCL8/IL-8 Polyclonal antibody (Cat# 27095-1-AP) has accumulated 107 citations published in over 80 journals, including high-impact titles such as Nature, Cell, Cancer Cell, Nat Metab, Nat Commun, Oncogene, and Int Immunopharmacol. The associated research spans oncology (esophageal, breast, gastric, liver, and prostate cancers), inflammation and immunology, cellular senescence, cardiovascular disease, fibrosis, neurodegeneration, diabetes, and aging. Primary applications include WB, IHC, IF, and ELISA.
| Species | Application | Title |
|---|---|---|
Cell De novo assembly of nuclear stress bodies rearranges and enhances NFIL3 to restrain acute inflammatory responses | ||
Cancer Discov Mutational Signatures and Clonal Hematopoiesis in Intestinal Metaplasia across Countries with Varying Stomach Cancer Incidence. | ||
Nat Metab The flavonoid procyanidin C1 has senotherapeutic activity and increases lifespan in mice. | ||
Nat Commun Loss-of-function mutations in Keratin 32 gene disrupt skin immune homeostasis in pityriasis rubra pilaris |
Reviews
What customers say
One customer (Maggie Orozco Moreno) rated this antibody 5 out of 5 stars in December 2025. She used it for immunofluorescence on CWR22Rv1 human prostate cancer cells at a 1:200 dilution. Her protocol involved overnight incubation at 4°C followed by secondary antibody incubation for 1 hour at room temperature. The review was positive overall, with no negative comments noted.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Maggie (Verified Customer) (12-08-2025) | Overnight incubation at 4°C. Secondary antibody incubation for 1 hr at RT.
 |
