Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

calreticulin Polyclonal antibody

calreticulin Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), CoIP, ELISA

CALR, Calregulin, CRT

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for calreticulin in ?

Tested Applications

Positive WB detected inHeLa cells, mouse skeletal muscle tissue, C6 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue, SH-SY5Y cells
Positive IHC detected inhuman thyroid tissue, human colon tissue, human kidney tissue, mouse brain tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse kidney tissue
Positive IF-Fro detected inmouse kidney tissue
Positive IF/ICC detected inHepG2 cells, SKOV-3 cells, HeLa cells, U2OS cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27298-1-AP targets calreticulin in WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, monkey, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26064

Product name: Recombinant human calreticulin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 248-417 aa of BC002500

Sequence: KKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

Predict reactive species
Full Name calreticulin
Calculated Molecular Weight 60 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC002500
Gene Symbol Calreticulin
Gene ID (NCBI) 811
RRIDAB_2880835
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP27797
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CALR,also named as grp60, ERp60, HACBP, CRP55, CRTC and Calregulin, belongs to the calreticulin family. It is a molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. CALR is a ER marker. It interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. CALR interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. The MW of CALR migrates aberrantly at 60 kD by SDS-PAGE. Some study provided that it's a new possibility for CRT-mediated tumor immune prevention and treatment.

Protocols

Product Specific Protocols
FC protocol for calreticulin antibody 27298-1-APDownload protocol
IF protocol for calreticulin antibody 27298-1-APDownload protocol
IHC protocol for calreticulin antibody 27298-1-APDownload protocol
WB protocol for calreticulin antibody 27298-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Calreticulin antibody (Cat# 27298-1-AP) has accumulated 192 citations across high-impact journals including Nature Communications, Cell Metabolism, Immunity, Advanced Materials, ACS Nano, Biomaterials, Theranostics, Journal of Controlled Release, Small, and Science Advances. Research fields span cancer immunotherapy, ferroptosis, pyroptosis, cuproptosis, immunogenic cell death, ER stress, STING signaling, PD-L1 checkpoint blockade, nanomedicine, autophagy, Golgi biology, and neurodegeneration. The antibody is predominantly used in IF and WB applications in mouse and human models.

SpeciesApplicationTitle
mouse,humanIF

Signal Transduct Target Ther

Chemo-photothermal synergy ignites antitumor immunity via ferroptosis.

Authors - Jundong Lin
humanWB

Cell Metab

Transient Receptor Potential V Channels Are Essential for Glucose Sensing by Aldolase and AMPK.

Authors - Mengqi Li

Cell Res

Tumor PD-L1 induces β2m ubiquitylation and degradation for cancer cell immune evasion.

Authors - Qiuling Zhao
humanIF

Immunity

A chemical agonist and the Golgi-resident lipid PI4P activate STING by inducing transmembrane helix rearrangement.

Authors - Jing Han
mouseIF

Exploration (Beijing)

NIR II-Guided Photoactivatable Silencing Polyplex Boosts Cancer Immunotherapy.

Authors - Yuquan Zhang
mouse

Adv Mater

Elucidation of Spatial Cooperativity in Chemo-Immunotherapy by a Sequential Dual-pH-Responsive Drug Delivery System

Authors - Shihao Wang
Loading...
||
New chat

Able™

正在加载,请稍候...