Tested Applications
| Positive WB detected in | HeLa cells, mouse skeletal muscle tissue, C6 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue, SH-SY5Y cells |
| Positive IHC detected in | human thyroid tissue, human colon tissue, human kidney tissue, mouse brain tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse kidney tissue |
| Positive IF-Fro detected in | mouse kidney tissue |
| Positive IF/ICC detected in | HepG2 cells, SKOV-3 cells, HeLa cells, U2OS cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27298-1-AP targets calreticulin in WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26064 Product name: Recombinant human calreticulin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 248-417 aa of BC002500 Sequence: KKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL Predict reactive species |
| Full Name | calreticulin |
| Calculated Molecular Weight | 60 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC002500 |
| Gene Symbol | Calreticulin |
| Gene ID (NCBI) | 811 |
| RRID | AB_2880835 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P27797 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CALR,also named as grp60, ERp60, HACBP, CRP55, CRTC and Calregulin, belongs to the calreticulin family. It is a molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. CALR is a ER marker. It interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. CALR interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. The MW of CALR migrates aberrantly at 60 kD by SDS-PAGE. Some study provided that it's a new possibility for CRT-mediated tumor immune prevention and treatment.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for calreticulin antibody 27298-1-AP | Download protocol |
| IF protocol for calreticulin antibody 27298-1-AP | Download protocol |
| IHC protocol for calreticulin antibody 27298-1-AP | Download protocol |
| WB protocol for calreticulin antibody 27298-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-Calreticulin (CALR) antibody 27298-1-AP has accumulated 189 citations published in high-impact journals including Nature Communications, Nature Cell Biology, Cell Metabolism, Immunity, Science Translational Medicine, Biomaterials, Advanced Materials, ACS Nano, Theranostics, Journal of Controlled Release, Molecular Cell, Neuron, and Journal of the American Chemical Society. Associated research fields encompass cancer immunotherapy, immunogenic cell death, ferroptosis, pyroptosis, cuproptosis, PANoptosis, nanomedicine, endoplasmic reticulum stress, autophagy, STING signaling, PD-L1 regulation, Golgi apparatus biology, and neurodegeneration.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Chemo-photothermal synergy ignites antitumor immunity via ferroptosis. | ||
Cell Metab Transient Receptor Potential V Channels Are Essential for Glucose Sensing by Aldolase and AMPK. | ||
Cell Res Tumor PD-L1 induces β2m ubiquitylation and degradation for cancer cell immune evasion. | ||
Immunity A chemical agonist and the Golgi-resident lipid PI4P activate STING by inducing transmembrane helix rearrangement. | ||
Exploration (Beijing) NIR II-Guided Photoactivatable Silencing Polyplex Boosts Cancer Immunotherapy. | ||
Adv Mater Elucidation of Spatial Cooperativity in Chemo-Immunotherapy by a Sequential Dual-pH-Responsive Drug Delivery System |
