CoraLite® Plus 555-conjugated calreticulin Polyclonal antibody

• 

  IF Staining of HepG2 using CL555-27298

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 555 calreticulin antibody (CL555-27298) at dilution of 1:200, CL488-phalloidin (green).

• 

  IF Staining of SKOV-3 using CL555-27298

  Immunofluorescent analysis of (4% PFA) fixed SKOV-3 cells using CoraLite® Plus 555 calreticulin antibody (CL555-27298) at dilution of 1:200.

• 

  IF Staining of U2OS using CL555-27298

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using CoraLite® Plus 555 calreticulin antibody (CL555-27298) at dilution of 1:200.

• 

  FC experiment of HeLa using CL555-27298

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite® Plus 555 Anti-Human calreticulin (CL555-27298) (red), or 0.4 ug CoraLite®555-conjugated Rabbit IgG control Rabbit PolyAb (CL555-30000, Clone: ) (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set.

• Featured Product
• KD/KO Validated

calreticulin Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL555-27298

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

CALR, Calregulin, CRT

---

Tested Applications

• Positive IF/ICC detected in: U2OS cells, SKOV-3 cells, HepG2 cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

CL555-27298 targets calreticulin in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26064

  Product name: Recombinant human calreticulin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 248-417 aa of BC002500

  Sequence: KKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

• Full Name: calreticulin
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC002500
• Gene Symbol: Calreticulin
• Gene ID (NCBI): 811
• RRID: AB_3084533
• Conjugate: CoraLite® Plus 555 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 554 nm / 570 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P27797
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CALR, also named as grp60, ERp60, HACBP, CRP55, CRTC and Calregulin, belongs to the calreticulin family. It is a molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. CALR is an ER marker. It interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. CALR interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. The MW of CALR migrates aberrantly at 60 kD by SDS-PAGE. Some study provided that it's a new possibility for CRT-mediated tumor immune prevention and treatment.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Biomaterials; A cuproptosis-based nanomedicine suppresses triple negative breast cancers by regulating tumor microenvironment and eliminating cancer stem cells; Authors - Chen Xiao