DIRAS2 Recombinant monoclonal antibody

DIRAS2 Uni-rAb® Recombinant Antibody for WB, IHC, ELISA

Cat No. 86460-1-RR
Clone No.251286F3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

GTP binding protein Di Ras2, GTP-binding protein Di-Ras2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue, fetal human brain tissue, mouse cerebellum tissue, rat cerebellum tissue
Positive IHC detected inhuman colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86460-1-RR targets DIRAS2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7926

Product name: Recombinant human DIRAS2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-199 aa of BC008065

Sequence: MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVIM

Predict reactive species
Full Name DIRAS family, GTP-binding RAS-like 2
Calculated Molecular Weight 22 kDa
Observed Molecular Weight 22 kDa
GenBank Accession NumberBC008065
Gene Symbol DIRAS2
Gene ID (NCBI) 54769
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96HU8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GTP-binding protein Di-Ras2 (DIRAS2) is a member of the Ras-related small G-protein family. DIRAS2 regulated the phosphorylation of downstream effector proteins and activated the RAS/mitogen-activated protein kinase (MAPK) signaling pathway (PMID: 3216131). DIRAS2 interacted with 26S proteasome non-ATPase regulatory subunit 2, which facilitates the degradation of DIRAS2 in a proteasome-mediated way. DIRAS2 blocked nuclear factor kappa light-chain enhancer of activated B-cell (NF-κB) signaling pathways, inducing G0/G1 arrest. DIRAS2 inhibited CRC cell proliferation and affected cell-cycle protein expression (PMID: 35173535). DIRAS2 was proved to be an oncogene that activated the RAS-MAPK pathway to induce cell proliferation and metastasis in renal cell cancer (PMID: 3216131). DIRAS2 also shows its activity as a tumor-suppressor gene to induce autophagic cell death via modulating nuclear localization FOXO3/FOXO3A and TFEB (PMID: 29368982).

Protocols

Product Specific Protocols
IHC protocol for DIRAS2 antibody 86460-1-RRDownload protocol
WB protocol for DIRAS2 antibody 86460-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...