DNA ligase III/LIG3 Recombinant monoclonal antibody

DNA ligase III/LIG3 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 85409-4-RR
Clone No.242870C6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

LIG3, 242870C6, DNA ligase 3, DNA ligase III, EC:6.5.1.1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, MOLT-4 cells, HEK-293 cells, HeLa cells, PC-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85409-4-RR targets DNA ligase III/LIG3 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag24917

Product name: Recombinant human LIG3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 254-390 aa of BC068005

Sequence: CDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFHGDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQSKSFPPAAKSLLTIQEVDEFLLRLSKLTKE

Predict reactive species
Full Name ligase III, DNA, ATP-dependent
Calculated Molecular Weight 100-110 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC068005
Gene Symbol LIG3
Gene ID (NCBI) 3980
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP49916
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DNA ligase III (DNA ligase 3) is an enzyme that in humans is encoded by the LIG3 gene. The human LIG3 gene encodes ATP-dependent DNA ligases that seal interruptions in the phosphodiester backbone of duplex DNA. There are three families of ATP-dependent DNA ligases in eukaryotes. These enzymes utilize the same three step reaction mechanism; 1 formation of a covalent enzyme-adenylate intermediate; 2 transfer of the adenylate group to the 5' phosphate terminus of a DNA nick; 3 phosphodiester bond formation. Unlike LIG1 and LIG4 family members that are found in almost all eukaryotes, LIG3 family members are less widely distributed. The LIG3 gene encodes several distinct DNA ligase species by alternative translation initiation and alternative splicing mechanisms.

Protocols

Product Specific Protocols
WB protocol for DNA ligase III/LIG3 antibody 85409-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...