Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

EPO/Erythropoietin Polyclonal antibody

EPO/Erythropoietin Polyclonal Antibody for WB, IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, ELISA

EPO, EP, Epoetin, erythropoietin, MVCD2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for EPO/Erythropoietin in ?

Tested Applications

Positive WB detected inHEK-293 cells
Positive IHC detected inrat kidney tissue, mouse spleen tissue, rat spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17908-1-AP targets EPO/Erythropoietin in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, rat, canine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12302

Product name: Recombinant human EPO protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 3-193 aa of BC093628

Sequence: VHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Predict reactive species
Full Name erythropoietin
Calculated Molecular Weight 193 aa, 21 kDa
Observed Molecular Weight 37 kDa
GenBank Accession NumberBC093628
Gene Symbol EPO/Erythropoietin
Gene ID (NCBI) 2056
RRIDAB_10638147
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP01588
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Erythropoietin (Epo) is a member of the EPO/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. Erythropoietin (Epo) is a 166 amino acids protein containing three N-glycosylation sites (Asn-24, Asn-38, and Asn-83) and 1 O- glycosylation site (Ser-126) and involved in the regulation of the level of red blood cells. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. Its effect is realized by binding erythropoietin receptor (EpoR) expressed on erythroid progenitor cells. EpoR, is a glycoprotein expressed on megakaryocytes, erythroid progenitors and endothelial cells. Epo also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types.

Protocols

Product Specific Protocols
IHC protocol for EPO/Erythropoietin antibody 17908-1-APDownload protocol
WB protocol for EPO/Erythropoietin antibody 17908-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The EPO/Erythropoietin Polyclonal antibody (Cat# 17908-1-AP) has 5 citations published in Frontiers in Pharmacology, Frontiers in Molecular Neuroscience, International Journal of Clinical Oncology, Frontiers in Genetics, and Journal of Veterinary Medical Science. Research fields span liver ischemia-reperfusion injury, neuroprotective cytokine signaling, hypoxia-driven oral squamous cell carcinoma, hepatocellular carcinoma prognosis, and canine renal interstitial tumors. Applications cited include Western blot and immunohistochemistry across human, rat, and canine species.

SpeciesApplicationTitle
ratWB

Front Pharmacol

Dimethyloxalylglycine pretreatment of living donor alleviates both donor and graft liver ischemia-reperfusion injury in rats

Authors - Degong Jia
humanWB

Front Mol Neurosci

The cytokine receptor CRLF3 is a human neuroprotective EV-3 (Epo) receptor

Authors - Debbra Y Knorr
humanIHC

Front Genet

Identification and Validation of a Tumor Microenvironment-Related Gene Signature in Hepatocellular Carcinoma Prognosis.

Authors - Changjing Huang
humanWB

Int J Clin Oncol

The miR-199a-5p/HIF1α dual-regulatory axis participates in hypoxia-induced aggressive phenotypes of oral squamous cell carcinoma (OSCC) cells

Authors - Xing Chen
canineIHC

J Vet Med Sci

Suspected renal interstitial cell tumor causing polycythemia in two dogs

Authors - Kaori Ide
Loading...
||
New chat

Able™

正在加载,请稍候...