Tested Applications
| Positive WB detected in | mouse brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human lung cancer tissue, mouse spleen tissue, human breast cancer tissue, rat lung tissue, rat spleen tissue, mouse heart tissue, mouse lung tissue, human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:150-1:600 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27056-1-AP targets FBP17 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25784 Product name: Recombinant human FNBP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 176-241 aa of BC101755 Sequence: AQIRHQMAEDSKADYSSILQKFNHEQHEYYHTHIPNIFQKIQEMEERRIVRMGESMKTYAEVDRQV Predict reactive species |
| Full Name | formin binding protein 1 |
| Observed Molecular Weight | 80-85 kDa |
| GenBank Accession Number | BC101755 |
| Gene Symbol | FBP17 |
| Gene ID (NCBI) | 23048 |
| RRID | AB_2880734 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96RU3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FBP17 (formin-binding protein 17) is a new dynamin-associating molecule consisting of several functional domains, including an N-terminal EFC domain and an SH3 domain at the C-terminus. FBP17 is involved in dynamin-mediated endocytosis and has been reported to be required for invadopodia formation and tumor cell invasion.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for FBP17 antibody 27056-1-AP | Download protocol |
| IP protocol for FBP17 antibody 27056-1-AP | Download protocol |
| WB protocol for FBP17 antibody 27056-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The FBP17 Polyclonal antibody (Cat# 27056-1-AP) has 2 citations. Both appear in neuroscience research focusing on F-BAR proteins CIP4 and FBP17 in cortical neuron radial migration and process outgrowth. The citations are published in Journal of Neuroscience (2025) and bioRxiv (2024), with applications in Western blot for mouse and human samples respectively.
| Species | Application | Title |
|---|---|---|
J Neurosci F-BAR Proteins CIP4 and FBP17 Function in Cortical Neuron Radial Migration and Process Outgrowth. | ||
bioRxiv F-BAR proteins CIP4 and FBP17 function in cortical neuron radial migration and process outgrowth |
Reviews
What customers say
Users report the antibody performs well for Western blot at 1:1000 dilution, detecting FBP17 at the expected ~80 kDa in iPSCs and iNeurons. One user noted a strong non-specific band at 70 kDa across all samples, including mouse neurons where no specific signal was detected. For immunofluorescence, one reviewer observed persistent background despite multiple detergent washes. Overall, the antibody is considered reliable for WB but may require optimization to reduce non-specific binding in some applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Cicek (Verified Customer) (06-11-2024) | I tested the antibody on mouse neurons, iPSCs and 3-weeks-old iNeurons with Western blotting using beta-actin as positive control. There were bands at the 80 kDa mark showing FBP17 for iPSC and iNeurons, but not mouse neurons. All samples showed a strong unspecific band at 70 kDa mark.
|
María (Verified Customer) (02-08-2022) | Works fine for WB (1:1000), for IF some background, even after several washes with detergent
|
