Filter: AllWBIHC

WB analysis of human placenta using 21541-1-AP
human placenta tissue were subjected to SDS PAGE followed by western blot with 21541-1-AP (FCGR2B / CD32b antibody at dilution of 1:300 incubated at room temperature for 1.5 hours.
WB analysis of Raji using 21541-1-AP
Raji cells were subjected to SDS PAGE followed by western blot with 21541-1-AP (FCGR2B / CD32b antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.
IHC staining of human tonsillitis using 21541-1-AP
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 21541-1-AP (FCGR2B / CD32b antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human tonsillitis using 21541-1-AP
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 21541-1-AP (FCGR2B / CD32b antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human placenta using 21541-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 21541-1-AP (FCGR2B / CD32b antibody at dilution of 1:200 (under 10x lens).
IHC staining of human placenta using 21541-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 21541-1-AP (FCGR2B / CD32b antibody at dilution of 1:200 (under 40x lens).
IHC staining of human spleen using 21541-1-AP
Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 21541-1-AP (FCGR2B / CD32b antibody at dilution of 1:200 (under 10x lens).
IHC staining of human spleen using 21541-1-AP
Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 21541-1-AP (FCGR2B / CD32b antibody at dilution of 1:200 (under 40x lens).
IHC staining of human tonsillitis using 21541-1-AP
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 21541-1-AP (FCGR2B / CD32b antibody at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

FCGR2B / CD32b Polyclonal antibody

FCGR2B / CD32b Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21541-1-AP

Publications(1)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

FCGR2B, Fc-gamma RII-b, FCG2, Fc gamma RIIb, Fc gamma RII b

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	human placenta tissue, Raji cells
Positive IHC detected in	human tonsillitis tissue, human placenta tissue, human spleen tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:200-1:1000
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21541-1-AP targets FCGR2B / CD32b in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag16189 Product name: Recombinant human FCGR2B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 254-310 aa of BC031992 Sequence: ALPGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDALEEPDDQNRI Predict reactive species
Full Name	Fc fragment of IgG, low affinity IIb, receptor (CD32)
Calculated Molecular Weight	310 aa, 34 kDa
Observed Molecular Weight	36 kDa
GenBank Accession Number	BC031992
Gene Symbol	CD32b
Gene ID (NCBI)	2213
RRID	AB_2878881
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P31994
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for FCGR2B / CD32b antibody 21541-1-AP	Download protocol
WB protocol for FCGR2B / CD32b antibody 21541-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

All (1)

Species	Application	Title
		Mol Ther High-dose systemic adeno-associated virus vector administration causes liver and sinusoidal endothelial cell injury Authors - Juliette Hordeaux View Article