Tested Applications
| Positive WB detected in | PC-12 cells, COLO 320 cells, human brain tissue, human testis tissue, mouse brain tissue, rat brain tissue, SH-SY5Y cells |
| Positive IHC detected in | rat brain tissue, human brain tissue, human liver tissue, human ovary tissue, human skin tissue, human spleen tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | PC-12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15805-1-AP targets FXYD6 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8538 Product name: Recombinant human FXYD6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 23-95 aa of BC018652 Sequence: KEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAPGDEEAQVENLITANATEPQKAEN Predict reactive species |
| Full Name | FXYD domain containing ion transport regulator 6 |
| Calculated Molecular Weight | 95 aa, 11 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | BC018652 |
| Gene Symbol | FXYD6 |
| Gene ID (NCBI) | 53826 |
| RRID | AB_2108625 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H0Q3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The FXYD family is a group of small single-span transmembrane proteins characterized by a signature sequence containing an FXYD motif, two conserved glycines and a serine residue. Members of the FXYD family, including FXYD1 (phospholemman), FXYD2 (gamma subunit of Na,K-ATPase), FXYD3 (Mat8), FXYD4 (CHIF), FXYD5 (RIC), FXYD6 (phosphohippolin) and FXYD7, are tissue specific regulators of the Na,K-ATPase. FXYD6 is primarily expressed in the brain. It modulates the kinetic activity of Na,K-ATPase and has long-term physiological importance in maintaining cation homeostasis. It may play a role in endolymph composition and has a potential important role in neuronal excitability of the CNS during postnatal development and in the adult brain. On the SDS-PAGE FXYD6 migrates with an apparent molecular weight of approximately 20 kDa, which is larger than the calculated molecular weight of 10.5 kDa (PMID: 15193427; 17209044). The gene encodes FXYD6 is located on chromosome 11q23.3, and it might be a susceptibility gene of schizophrenia.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for FXYD6 antibody 15805-1-AP | Download protocol |
| IHC protocol for FXYD6 antibody 15805-1-AP | Download protocol |
| WB protocol for FXYD6 antibody 15805-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The FXYD6 Antibody (Cat# 15805-1-AP) has 5 total citations. These appear in J Am Soc Nephrol, Front Immunol, Cancer Med, Biomed Res Int, and Commun Biol. Research fields span renal endothelial biology, ovarian cancer prognostic subtyping, glioma biomarker identification, colorectal cancer chemosensitivity and autophagy, and neuromuscular junction spatial proteomics. Applications include IF, WB, and IP in both human and mouse samples.
| Species | Application | Title |
|---|---|---|
J Am Soc Nephrol Single-Cell RNA Sequencing Reveals Renal Endothelium Heterogeneity and Metabolic Adaptation to Water Deprivation. | ||
Front Immunol Identification of prognostic subtypes and the role of FXYD6 in ovarian cancer through multi-omics clustering | ||
Cancer Med Identification of FXYD6 as the novel biomarker for glioma based on differential expression and DNA methylation | ||
Biomed Res Int FXYD6 Regulates Chemosensitivity by Mediating the Expression of Na+/K+-ATPase α1 and Affecting Cell Autophagy and Apoptosis in Colorectal Cancer.
| ||
Commun Biol Spatial proteomics identifies FXYD6 as a dual-site protein of neuromuscular junction in the diaphragm. |
