GJB3 Fusion Protein

Source

e coli.-derived, T-HIS

Tag

6*His

Format

Liquid

Cat no : Ag3839

Synonyms

CX31; DFNA2; DFNA2B; EKV; FLJ22486; MGC102938



Product Information

Peptide Sequence RERRHRQKHGDQCAKLYDNAGKKHGGLWWTYLFSLIFKLIIEFLFLYLLHTLWHGFNMPRLVQCANVAPCPNIVDCYIARPTEKKIFTYFMVGASAVCIVLTICELCYLICHRVLRGLHKDKPRGGCSPSSSASRASTCRCHHKLVEAGEVDPDPGNNKLQASAPNLTPI
(101-270 aa encoded by BC012918)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Formulation The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7. ) added with 300mM Imidazole and 15%glycerol.