GPX8 Recombinant monoclonal antibody

GPX8 Uni-rAb® Recombinant Antibody for WB, IHC, ELISA
Cat No. 85120-1-RR
Clone No.242769C6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

242769C6, EC:1.11.1.9, GPx 8, GPx-8, GSHPx 8

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, U-87 MG cells, U2OS cells, NIH/3T3 cells, rat uterus tissue
Positive IHC detected inhuman stomach tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:1250-1:5000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85120-1-RR targets GPX8 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9930

Product name: Recombinant human GPX8 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 38-209 aa of BC029424

Sequence: KFLKPKINSFYAFEVKDAKGRTVSLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWRPEEPIEVIRPDIAALVRQVIIKKKEDL

Predict reactive species
Full Name glutathione peroxidase 8 (putative)
Calculated Molecular Weight 209 aa, 24 kDa
Observed Molecular Weight 24 kDa
GenBank Accession NumberBC029424
Gene Symbol GPX8
Gene ID (NCBI) 493869
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8TED1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPX8(Probable glutathione peroxidase 8) is also named as GSHPx-8 and belongs to the glutathione peroxidase family. Glutathione peroxidase (GPx) reduces hydroperoxides, including hydrogen peroxides, in the presence of reduced glutathione as a means of protecting organisms from oxidative damage. Several GPx isozymes have been identified in animal cells and these have been classified into different groups according to their cellular location and substrate specificity. In humans, eight types of GPx have been identified from GPx1 to GPx8. The full length GPX8 has 209 amino acids and the molecular weight is 24 kDa.

Protocols

Product Specific Protocols
IHC protocol for GPX8 antibody 85120-1-RRDownload protocol
WB protocol for GPX8 antibody 85120-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...