HDAC1 Monoclonal antibody

HDAC1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 66085-1-Ig
Clone No.4C4G7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ChIP, ELISA

4C4G7, EC:3.5.1.-, EC:3.5.1.98, GON 10, HD1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells
Positive IHC detected inhuman lymphoma tissue, human lung cancer tissue, human prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:2000-1:10000
Immunofluorescence (IF)/ICCIF/ICC : 1:6000-1:24000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66085-1-Ig targets HDAC1 in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19128

Product name: Recombinant human HDAC1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 184-482 aa of BC000301

Sequence: EEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA

Predict reactive species
Full Name histone deacetylase 1
Calculated Molecular Weight 55 kDa
Observed Molecular Weight 65 kDa
GenBank Accession NumberBC000301
Gene Symbol HDAC1
Gene ID (NCBI) 3065
RRIDAB_11232033
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ13547
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Histone deacetylases(HDAC) are a class of enzymes that remove the acetyl groups from the lysine residues leading to the formation of a condensed and transcriptionally silenced chromatin. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family and is a component of the histone deacetylase complex, which is responsible for gene expression silencing. It also plays an important role in the control of cell proliferation and differentiation by interacting with RB, p53 and other transcription factors. At least 4 classes of HDAC were identified. As a class I HDAC, HDAC 1 was primarily found in the nucleus. This antibody is raised against residues near the C terminus of human HDAC1. The calculated molecular weight of HDAC1 is 55 kDa, but modified HDAC1 is about 60-65 kDa .

Protocols

Product Specific Protocols
IF protocol for HDAC1 antibody 66085-1-IgDownload protocol
IHC protocol for HDAC1 antibody 66085-1-IgDownload protocol
WB protocol for HDAC1 antibody 66085-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Mol Cancer

Exosomal circ_0006896 promotes AML progression via interaction with HDAC1 and restriction of antitumor immunity

Authors - Can Can
mouseWB

Immunity

Histone Deacetylases 1 and 2 Regulate Microglia Function during Development, Homeostasis, and Neurodegeneration in a Context-Dependent Manner.

Authors - Moumita Datta
humanIF

Nat Commun

YTHDF2 upregulation and subcellular localization dictate CD8 T cell polyfunctionality in anti-tumor immunity

Authors - Haiyan Zhang
humanWB

J Clin Invest

The FOXN3-NEAT1-SIN3A repressor complex promotes progression of hormonally responsive breast cancer.

Authors - Wanjin Li
humanWB

Nat Commun

ZNF516 suppresses EGFR by targeting the CtBP/LSD1/CoREST complex to chromatin.

Authors - Lifang Li
mouseWB

Br J Pharmacol

Physalin B attenuates liver fibrosis via suppressing LAP2α-HDAC1-mediated deacetylation of the transcription factor GLI1 and hepatic stellate cell activation.

Authors - Xiaoyun Zhu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Tsimafei (Verified Customer) (08-04-2024)

Antibody were incubated at 4C, ON

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:10000
  • Cell Tissue Type: mESCs
HDAC1 Antibody Western Blot validation (1:10000 dilution) in mESCs (Cat no:66085-1-Ig)
FH

Xiaoyu (Verified Customer) (06-28-2023)

Excellent antibody for WB

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: 293T
HDAC1 Antibody Western Blot validation (1:1000 dilution) in 293T (Cat no:66085-1-Ig)
FH

Andrea (Verified Customer) (01-11-2023)

Excellent antibody

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: mESCs
HDAC1 Antibody Western Blot validation (1:5000 dilution) in mESCs (Cat no:66085-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...