IL-10 Recombinant monoclonal antibody

IL-10 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 82793-16-RR
Clone No.1A4

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, ELISA

Il10, IL-10,IL10, 1A4, interleukin 10, interleukin-10

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRecombinant protein

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

82793-16-RR targets IL-10 in WB, ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0269

Product name: Recombinant Rat IL-10 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 19-178 aa of NM_012854

Sequence: MSKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN

Predict reactive species
Full Name interleukin 10
Calculated Molecular Weight20kd
Observed Molecular Weight30 kDa
GenBank Accession NumberNM_012854
Gene Symbol IL-10
Gene ID (NCBI) 25325
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP29456
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The human IL10 gene is 4.7 kb in size and is located on the long arm of chromosome 1. It contains five exons. Biologically functional IL-10 exists in the form of a 36 kDa homodimer composed of two non-covalently bonded mono-mers each with 160 amino acids length. IL-10 is an anti-inflammatory cytokine, produced by T helper (Th) cells, macrophages, monocytes, and B cells, that plays a crucial role in preventing inflammatory and autoimmune pathologies. It downregulates the expression of Th1 cytokines, MHC class II antigens, and co-stimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. IL-10 can block NF-κB activity, and is involved in the regulation of the JAK-STAT signaling pathway. IL-10, along with its receptors, describes an important role in pathogenesis of various diseases, including infectious, inflammatory, autoimmune diseases. IL-10 mutations are associated with an increased susceptibility to HIV-1 infection and rheumatoid arthritis.

Publications

SpeciesApplicationTitle
mouseWB

J Nanobiotechnology

Neutrophil N1 polarization induced by cardiomyocyte-derived extracellular vesicle miR-9-5p aggravates myocardial ischemia/reperfusion injury

Authors - Yeshen Zhang
Loading...
||
New chat

Able

正在加载,请稍候...