Tested Applications
| Positive WB detected in | HEK-293 cells, MCF-7 cells, HT-1080 cells, HeLa cells |
| Positive IP detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20433-1-AP targets INSR/CD220 in WB, IHC, IF, IP, CoIP, Dot blot, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, pig, zebrafish, bovine, fish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13922 Product name: Recombinant human INSR protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 968-1370 aa of BC117172 Sequence: RKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS Predict reactive species |
| Full Name | INSR |
| Calculated Molecular Weight | 1382 aa, 156 kDa |
| Observed Molecular Weight | 190 kDa, 135 kDa, 95 kDa |
| GenBank Accession Number | BC117172 |
| Gene Symbol | INSR |
| Gene ID (NCBI) | 3643 |
| RRID | AB_10646469 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P06213 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The biological effects of INS are mediated by a membrane-spanning cell surface receptor that has been shown to consist of disulfide-linked alpha-subunits (135 kDa) and beta-subunits (95 kDa) that are cleaved products of a common precursor. The binding of INS to the receptor extracellular domain results in intracellular activation of a tyrosine-specific kinase activity and the generation of signals that determine the cellular response (PMID: 2369896). This antibody raised against 980-1382aa of human INS receptor can recognize full-length INS receptor precursor and INS receptor beta subunit.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for INSR/CD220 antibody 20433-1-AP | Download protocol |
| WB protocol for INSR/CD220 antibody 20433-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The INSR/CD220 Polyclonal antibody (Cat# 20433-1-AP) has 43 citations published in journals including Nature Biotechnology, Cell Reports, EMBO Reports, FASEB Journal, Biomaterials, British Journal of Surgery, and World Journal of Diabetes. Research fields span insulin signaling, glucose/lipid metabolism, type 2 diabetes, autophagy, cancer, neurodegeneration, wound healing, food science, and pharmacology.
| Species | Application | Title |
|---|---|---|
Biomaterials Sprayable polysaccharide-based biomimetic double dressing with synergistic regulation for wound healing. | ||
Environ Health Perspect Effects of Chronic Secondhand Smoke (SHS) Exposure on Cognitive Performance and Metabolic Pathways in the Hippocampus of Wild-Type and Human Tau Mice. | ||
Br J Surg MiR-128 regulation of glucose metabolism and cell proliferation in triple-negative breast cancer. | ||
Int J Biol Macromol Lycium barbarum polysaccharide mitigates high-fat-diet-induced skeletal muscle atrophy by promoting AMPK/PINK1/Parkin-mediated mitophagy | ||
Cell Rep Ptprf is the conserved receptor for Asprosin's glucogenic effects in vertebrates. |
Reviews
What customers say
Reviews are mixed. One user (4/5) reported strong IF signals in human white adipocytes at 1:500. Another (3/5) found it functional for WB in mesenchymal stem cells at 1:1000 but noted three bands appeared. A third reviewer (1/5) raised serious specificity concerns: the antibody detected a ~180 kDa PNGaseF-sensitive band far larger than expected InsR, while a different brand's InsR antibody confirmed the correct molecular weight on the same membrane. Overall, results are application- and sample-dependent, with notable concerns about off-target binding in WB.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Mi (Verified Customer) (05-29-2023) | It works well in human white adipocytes, we get strong signals
|
Chiara (Verified Customer) (10-04-2021) | Works well but three bands
|
Boyan (Verified Customer) (06-06-2021) | This antibody recognized a band at ~ 180 kd only, which is sensitive to PNGaseF, but not EndoH, treatment. The size is much bigger than an expected InsR band. Importantly, stripping the membrane and re-blot with another InsR antibody from a different brand could detect the protein at the expected MW. These results suggest this InsR antibody is detecting something other than InsR.
|
