Tested Applications
| Positive WB detected in | HUVEC cells, A549 cells, MCF-7 cells, human placenta tissue |
| Positive IHC detected in | human Hepatocellular carcinoma, human breast cancer tissue, human liver cancer tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
| Positive FC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| Flow Cytometry (FC) | FC : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27096-1-AP targets Integrin alpha V in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25825 Product name: Recombinant human ITGAV protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 819-915 aa of BC136442 Sequence: SFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQ Predict reactive species |
| Full Name | integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) |
| Calculated Molecular Weight | 1048 aa, 116 kDa |
| Observed Molecular Weight | 120-130 kDa, 27 kDa |
| GenBank Accession Number | BC136442 |
| Gene Symbol | Integrin alpha V |
| Gene ID (NCBI) | 3685 |
| RRID | AB_2880753 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P06756 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated alpha and beta subunits. Integrin alpha V, also known as CD51, is a type I transmembrane glycoprotein composed of an extracellular domain, a transmembrane region and cytoplasmic domain (PMID: 2430295; 1690718). It can form heterodimers with one of the five beta integrin subunits (beta 1, 3, 5, 6, 8) that recognize ligands containing the sequence Arg-Gly-Asp, such as vitronectin, fibronectin, and osteopontin (PMID: 37087799). Integrin alpha V mainly plays a role in extracellular matrix-mediated cell adhesion and migration, differentiation, wound healing, inflammation, tumorigenesis, proliferation, angiogenesis, and metastasis.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Integrin alpha V antibody 27096-1-AP | Download protocol |
| IF protocol for Integrin alpha V antibody 27096-1-AP | Download protocol |
| IHC protocol for Integrin alpha V antibody 27096-1-AP | Download protocol |
| WB protocol for Integrin alpha V antibody 27096-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Integrin alpha V (ITGAV) polyclonal antibody (cat# 27096-1-AP) has 38 total citations published in journals including Nature Metabolism, Nature Communications, Molecular Cell, Journal of Clinical Investigation, Current Biology, Science Advances, and FASEB Journal. Associated research fields encompass fibrosis, cancer (ovarian, glioma, pancreatic, breast), neurodegeneration, cardiovascular disease, wound healing, inflammation, viral infection, tissue engineering, and extracellular matrix biology.
| Species | Application | Title |
|---|---|---|
Nat Metab Early-activated extracellular matrix proteins shape the metabolic and spatial dynamics of the kidney fibrotic microenvironment. | ||
Nat Commun Saffold virus exploits integrin αvβ8 and sulfated glycosaminoglycans as cooperative attachment receptors for infection. | ||
Nat Commun Galectin-3-integrin α5β1 phase separation disrupted by advanced glycation end-products impairs diabetic wound healing in rodents. | ||
Nat Commun An enzyme-proof glycan glue for extracellular matrix to ameliorate intervertebral disc degeneration | ||
Mol Cell Cleavage of the pseudoprotease iRhom2 by the signal peptidase complex reveals an ER-to-nucleus signaling pathway | ||
Reviews
What customers say
All three reviews rate this antibody 5 stars. Users report clean Western blot bands at the expected molecular weight and strong focal adhesion staining in IF applications (LN229 cells at 1:200, oligodendrocytes at 1:500). One reviewer noted that while WB performance was excellent, IF did not produce a specific labeling pattern in MEFs. Overall, users find it reliable when following the recommended protocol, with particular praise for its crisp banding and crisp focal adhesion visualization.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Laura (Verified Customer) (08-28-2025) | It worked well with the protocol provided on the website
|
Alex (Verified Customer) (03-31-2025) | Exceptional focal adhesion staining in LN229 cells. Identity of the nuclear stain is unknown. Grayscale = Itgav antibody at 1:200. 4% formaldehyde fixation (methanol-free) with 0.1% Triton X-100 permeabilisation. Blocked in 2% BSA / 0.1% Triton X-100.
 |
Boyan (Verified Customer) (04-24-2019) | By WB, this antibody gave a clean band at the expected molecular weight; by IF, it could not label a specific pattern.
|
