Tested Applications
| Positive WB detected in | NIH/3T3 cells |
| Positive IP detected in | NIH/3T3 cells |
| Positive IHC detected in | human kidney tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17670-1-AP targets JAK2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11264 Product name: Recombinant human JAK2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 764-1129 aa of BC039695 Sequence: EDRHQLPAPKWAELANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG Predict reactive species |
| Full Name | Janus kinase 2 (a protein tyrosine kinase) |
| Calculated Molecular Weight | 1132 aa, 130 kDa |
| Observed Molecular Weight | 120-130 kDa |
| GenBank Accession Number | BC039695 |
| Gene Symbol | JAK2 |
| Gene ID (NCBI) | 3717 |
| RRID | AB_2811138 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O60674 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Janus kinases (JAKs) are non-receptor tyrosine kinases that are activated by cytokine binding to cytokine receptors resulting in stimulation of the JAK-STAT signaling pathway. Aberrant activation of this signaling pathway is associated with numerous immune disorders and cancer.
Publications
What published studies show
The anti-JAK2 antibody (Cat# 17670-1-AP) has accumulated 116 citations published in journals including ACS Nano, Theranostics, Advanced Science, Cell Death & Disease, Oncogene, Journal of Translational Medicine, and Frontiers in Immunology. Associated research fields span oncology (hepatocellular, lung, pancreatic, colorectal, and breast cancers), neurology (neuroinflammation, depression), immunology, cardiology, nephrology, and hepatology, with the JAK2/STAT3 signaling pathway as the predominant focus.
| Species | Application | Title |
|---|---|---|
ACS Nano Engineered Magneto-Piezoelectric Nanoparticles-Enhanced Scaffolds Disrupt Biofilms and Activate Oxidative Phosphorylation in Icam1+ Macrophages for Infectious Bone Defect Regeneration | ||
Theranostics Combination therapy with ropivacaine-loaded liposomes and nutrient deprivation for simultaneous cancer therapy and cancer pain relief. | ||
Adv Sci (Weinh) PDGF-BB-Dependent Neurogenesis Buffers Depressive-Like Behaviors by Inhibition of GABAergic Projection from Medial Septum to Dentate Gyrus | ||
Adv Sci (Weinh) MicroRNA-204-5p Deficiency within the vmPFC Region Contributes to Neuroinflammation and Behavioral Disorders via the JAK2/STAT3 Signaling Pathway in Rats | ||
Adv Sci (Weinh) Single-Cell Transcriptomics Reveals ITGA2-Mediated Metabolic Reprogramming and Immune Crosstalk in Pediatric Thyroid Carcinogenesis. | ||
Cell Death Dis Src acts as the target of matrine to inhibit the proliferation of cancer cells by regulating phosphorylation signaling pathways. |
Reviews
What customers say
One reviewer, Carly Garrison, gave this product a 5-star rating in November 2020. She tested the antibody using EDTA plasma on an antibody microarray and reported a positive experience with lot 00045168. Overall, the single review reflects satisfaction with the product's performance in a microarray-based application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Carly (Verified Customer) (11-17-2020) | Tested using EDTA plasma on an antibody microarray
|
