Tested Applications
| Positive WB detected in | HeLa cells, Jurkat cells, HEK-293 cells, HepG2 cells, HL-60 cells. HSC-T6 cells, NIH/3T3 cells |
| Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66848-1-Ig targets JTV1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0675 Product name: Recombinant human JTV1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC002853 Sequence: MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFS Predict reactive species |
| Full Name | JTV1 gene |
| Calculated Molecular Weight | 36 kDa |
| Observed Molecular Weight | 32-36 kDa |
| GenBank Accession Number | BC002853 |
| Gene Symbol | JTV1 |
| Gene ID (NCBI) | 7965 |
| RRID | AB_2882188 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q13155 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
JTV1, also named p38, AIMP2, was first knew as a factor associated with macromolecular protein complex, which consists several different aminoacyl-tRNA synthetases. JTV1 is a scaffold protein required for the assembly and stability of the multi-tRNA synthetase complex. JTV1 could act as a mediator of TGF-beta signaling and its functional importance in the control of MYC during lung differentiation. Blocks MDM2-mediated ubiquitination and degradation of p53/TP53. Functions as a proapoptotic factor.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for JTV1 antibody 66848-1-Ig | Download protocol |
| WB protocol for JTV1 antibody 66848-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









