JTV1 Monoclonal antibody, PBS Only

• 

  WB analysis using 66848-1-Ig (same clone as 66848-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66848-1-Ig (JTV1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66848-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66848-1-Ig (same clone as 66848-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66848-1-Ig (JTV1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66848-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 66848-1-Ig (same clone as 66848-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 66848-1-Ig (JTV1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66848-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 66848-1-Ig (same clone as 66848-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 66848-1-Ig (JTV1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66848-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 66848-1-Ig (same clone as 66848-1-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.8 ug JTV1 Monoclonal antibody (66848-1-Ig, Clone:1D6B5) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.8 ug Mouse IgG2b isotype control Mouse McAb (66360-3-Ig, Clone: 11B8C4) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 66848-1-PBS in a different storage buffer formulation.

JTV1 Monoclonal Antibody for WB, IHC, FC (Intra), Indirect ELISA

Cat No. 66848-1-PBS

Clone No.1D6B5

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), Indirect ELISA

Synonyms

1D6B5, AIMP2, Aminoacyl tRNA synthase complex-interacting multifunctional protein 2, HLD17, P38

---

Product Information

66848-1-PBS targets JTV1 in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0675

  Product name: Recombinant human JTV1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC002853

  Sequence: MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFS

• Full Name: JTV1 gene
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 32-36 kDa
• GenBank Accession Number: BC002853
• Gene Symbol: JTV1
• Gene ID (NCBI): 7965
• RRID: AB_2882188
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13155
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

JTV1, also named p38, AIMP2, was first knew as a factor associated with macromolecular protein complex, which consists several different aminoacyl-tRNA synthetases. JTV1 is a scaffold protein required for the assembly and stability of the multi-tRNA synthetase complex. JTV1 could act as a mediator of TGF-beta signaling and its functional importance in the control of MYC during lung differentiation. Blocks MDM2-mediated ubiquitination and degradation of p53/TP53. Functions as a proapoptotic factor.