CoraLite® Plus 488-conjugated JTV1 Monoclonal antibody

JTV1 Monoclonal Antibody for WB, FC (Intra)
Cat No. CL488-66848
Clone No.1D6B5

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, FC (Intra)

PRO0992, P38, HLD17, Aminoacyl tRNA synthase complex-interacting multifunctional protein 2, AIMP2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, HeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66848 targets JTV1 in WB, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0675

Product name: Recombinant human JTV1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-200 aa of BC002853

Sequence: MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFS

Predict reactive species
Full Name JTV1 gene
Calculated Molecular Weight 36 kDa
Observed Molecular Weight 32-36 kDa
GenBank Accession NumberBC002853
Gene Symbol JTV1
Gene ID (NCBI) 7965
RRIDAB_3672926
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13155
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

JTV1, also named p38, AIMP2, was first knew as a factor associated with macromolecular protein complex, which consists several different aminoacyl-tRNA synthetases. JTV1 is a scaffold protein required for the assembly and stability of the multi-tRNA synthetase complex. JTV1 could act as a mediator of TGF-beta signaling and its functional importance in the control of MYC during lung differentiation. Blocks MDM2-mediated ubiquitination and degradation of p53/TP53. Functions as a proapoptotic factor.

Protocols

Product Specific Protocols
WB protocol for CL Plus 488 JTV1 antibody CL488-66848Download protocol
FC protocol for CL Plus 488 JTV1 antibody CL488-66848Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...