CoraLite® Plus 488-conjugated JTV1 Monoclonal antibody

• 

  WB analysis using CL488-66848

  Various lysates were subjected to SDS PAGE followed by western blot with CL488-66848 (JTV1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  FC experiment of HeLa using CL488-66848

  1x10^6 HeLa cells were intracellularly stained with 0.8 ug CoraLite® Plus 488-conjugated JTV1 Monoclonal antibody (CL488-66848, Clone:1D6B5)(red), or 0.8 ug CoraLite® Plus 488 Mouse IgG2b isotype control (11B8C4) (CL488-66360-3, Clone: 11B8C4) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

JTV1 Monoclonal Antibody for WB, FC (Intra)

Cat No. CL488-66848

Clone No.1D6B5

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, FC (Intra)

Synonyms

1D6B5, AIMP2, Aminoacyl tRNA synthase complex-interacting multifunctional protein 2, HLD17, P38

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66848 targets JTV1 in WB, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0675

  Product name: Recombinant human JTV1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC002853

  Sequence: MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFS

• Full Name: JTV1 gene
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 32-36 kDa
• GenBank Accession Number: BC002853
• Gene Symbol: JTV1
• Gene ID (NCBI): 7965
• RRID: AB_3672926
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13155
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

JTV1, also named p38, AIMP2, was first knew as a factor associated with macromolecular protein complex, which consists several different aminoacyl-tRNA synthetases. JTV1 is a scaffold protein required for the assembly and stability of the multi-tRNA synthetase complex. JTV1 could act as a mediator of TGF-beta signaling and its functional importance in the control of MYC during lung differentiation. Blocks MDM2-mediated ubiquitination and degradation of p53/TP53. Functions as a proapoptotic factor.