Recombinant human JUN protein

Name: Recombinant human JUN protein
Brand: Proteintech
SKU: Ag17304

Source

e coli.-derived, PGEX-4T

Tag

GST

Format

Liquid

Cat no : Ag17304

Synonyms

AP 1, AP1, JUN, Activator protein 1, c Jun

Overview

Product Information
Reconstitution and Storage
Related Products (24)

Print datasheet

MSDS

Validation Data Gallery View All

JUN fusion protein Ag17304 SDS-PAGE

-/ -

Cat No. Ag17304

Freight/Packing: -

Country/Region

Size

Quantity

Please visit your regions distributor:

Request bulk or custom quote

Product Information

Peptide Sequence	PTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKE (92-227 aa encoded by BC068522)
Activity	Not tested.
Endotoxin Level	Please contact the lab for more information.
Formulation	The protein was expressed as GST-tagged fusion protein by E.Coli and purified by Glutathione-sepharose. The purified protein was resolved in PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4 ) added with 15% glycerol. The elution buffer contain 100mM GSH.

Shipping and Storage

Reconstitution	Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Shipping	The product is shipped with ice packs. Upon receipt, store it immediately at -20°C to -80°C.
Stability and Storage	Aliquot and store at -20°C to -80°C for up to 6 months. Avoid freeze thaw cycles.
Storage of Reconstituted Protein	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.

Recombinant human JUN protein

Validation Data Gallery View All

JUN fusion protein Ag17304 SDS-PAGE

Product Information

Shipping and Storage

Related Products

CoraLite® Plus 488-conjugated JUN Monoclonal antibody

CoraLite® Plus 488-conjugated JUN Polyclonal antibody

JUN Polyclonal antibody

JUN Polyclonal antibody

JUN Monoclonal antibody, PBS Only (Detector)

CoraLite® Plus 750-conjugated Phospho-JUN (Ser73) Recombinant antibody

CoraLite® Plus 488-conjugated Phospho-JUN (Ser73) Recombinant antibody

CoraLite® Plus 488-conjugated Phospho-JUN (Thr91/93) Recombinant antibody

CoraLite®594-conjugated Phospho-JUN (Ser73) Recombinant antibody

CoraLite®594-conjugated Phospho-JUN (Thr91/93) Recombinant antibody

Phospho-JUN (Ser73) Recombinant antibody, PBS Only

Phospho-JUN (Ser73) Recombinant antibody

Phospho-JUN (Thr91/93) Recombinant antibody, PBS Only

Phospho-JUN (Thr91/93) Recombinant antibody

CoraLite® Plus 647-conjugated Phospho-JUN (Ser73) Recombinant antibody

CoraLite® Plus 647-conjugated Phospho-JUN (Thr91/93) Recombinant antibody

Phospho-JUN (Ser63) Recombinant antibody, PBS Only

Phospho-JUN (Ser63) Recombinant antibody

Phospho-JUN (Ser73) Polyclonal antibody

Phospho-JUN (Ser73) Polyclonal antibody, PBS Only

Phospho-JUN (Ser63) Polyclonal antibody

JUN Monoclonal antibody

JUN Monoclonal antibody, PBS Only

JUN Monoclonal antibody, PBS Only (Capture)