Tested Applications
| Positive WB detected in | A375 cells, mouse thymus tissue, rat lung tissue, A549 cells, HEK-293T cells, Raji cells |
| Positive IP detected in | A549 cells |
| Positive IHC detected in | human lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12632-1-AP targets LAMP3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3325 Product name: Recombinant human LAMP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 30-380 aa of BC032940 Sequence: FPGTRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETVYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECSSDY Predict reactive species |
| Full Name | lysosomal-associated membrane protein 3 |
| Calculated Molecular Weight | 416 aa, 44 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC032940 |
| Gene Symbol | LAMP3 |
| Gene ID (NCBI) | 27074 |
| RRID | AB_2076629 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UQV4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LAMP3 (lysosome-associated membrane protein 3), also known as DC-LAMP (DC-lysosome-associated membrane glycoprotein), TSC403 or CD208, is a highly glycosylated lysosomal membrane protein that belongs to the LAMP family. The mature glycoprotein has an apparent molecular mass of 70-90 kDa, which is considerably larger than its predicted mass of 44 kDa (PMID: 9768752). LAMP3 is expressed in lung type II pneumocytes, lymphoid organs and dendritic cells. It might change the lysosome function after the transfer of peptide-MHC class II molecules to the surface of dendritic cells. LAMP3 mRNA is up-regulated in some human cancers (PMID:9721848). LAMP3 overexpression is associated with an enhanced metastatic potential and may be a prognostic factor for cervical cancer (PMID: 16204031).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LAMP3 antibody 12632-1-AP | Download protocol |
| IHC protocol for LAMP3 antibody 12632-1-AP | Download protocol |
| IP protocol for LAMP3 antibody 12632-1-AP | Download protocol |
| WB protocol for LAMP3 antibody 12632-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The LAMP3 Polyclonal antibody (Cat# 12632-1-AP) has 32 citations across 27 journals, including Nature Medicine, Nature Communications, Journal of Clinical Investigation, Autophagy, Arthritis & Rheumatology, and Scientific Reports. Research fields span lysosomal biology and autophagy, neurodegeneration (ALS/FTD, Alzheimer's), autoimmune diseases (Sjögren's syndrome), viral infections (influenza, KSHV), cancer (breast, osteosarcoma, pan-cancer), and pulmonary diseases (COPD, pulmonary fibrosis). Cited applications include WB, IF, and IHC.
| Species | Application | Title |
|---|---|---|
Nat Med Haploinsufficiency leads to neurodegeneration in C9ORF72 ALS/FTD human induced motor neurons. | ||
Autophagy LAMP3 inhibits autophagy and contributes to cell death by lysosomal membrane permeabilization. | ||
Autophagy Targeting the SNAI1-LAMP3 axis to restore lysosomal function and alleviate autophagic flux impairment to delay retinal degeneration. | ||
Protein Cell Regeneration of functional alveoli by adult human SOX9+ airway basal cell transplantation. | ||
Nat Commun Dstyk mutation leads to congenital scoliosis-like vertebral malformations in zebrafish via dysregulated mTORC1/TFEB pathway. | ||
J Clin Invest Lysosomal exocytosis of HSP70 stimulates monocytic BMP6 expression in Sjögren's syndrome. |
Reviews
What customers say
One reviewer (Ying Tian) rated this antibody 4 out of 5 stars in August 2019. They used it for Western Blot at a 1:1000 dilution on mouse lung tissues and described it as a "very good antibody." Overall, the limited feedback suggests reliable performance for WB applications in mouse tissue samples.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Ying (Verified Customer) (08-19-2019) | very good antibody
|
