MAP2 Polyclonal antibody

MAP2 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), IP, ELISA

Cat No. 17490-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), IP, ELISA

MAP 2, MAP-2, MAP2A, MAP2B, MAP2C

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSH-SY5Y cells, rat brain tissue, mouse brain tissue
Positive IP detected inSH-SY5Y cells, mouse brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat brain tissue, mouse brain tissue
Positive IF-Fro detected inmouse brain tissue, rat brain tissue
Positive IF/ICC detected iniPS cells
Positive FC (Intra) detected inNeuro-2a cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:2500-1:10000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:125-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17490-1-AP targets MAP2 in WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, monkey, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11580

Product name: Recombinant human MAP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 213-559 aa of BC038857

Sequence: TSAGSTDRLPYSKSGNKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTDNIKYQPKGGQVRILNKKIDFSKVQSRCGSKDNIKHSAGGGNVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTAALAKQGL

Predict reactive species
Full Name microtubule-associated protein 2
Calculated Molecular Weight 200 kDa
Observed Molecular Weight 280 kDa, 70-85 kDa
GenBank Accession NumberBC038857
Gene Symbol MAP2
Gene ID (NCBI) 4133
RRIDAB_2137880
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP11137
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Microtubule-associated protein 2 (MAP2) is a tubulin binding protein regulating the spacing and stability of microtubules and contributing to elongation of dendrites.

What is the molecular weight of MAP2? Is MAP2 post-translationally modified?

MAP2 has multiple isoforms that arise from alternative splicing (PMID: 3121794, 7854050, and 10383434). They are classified into two groups - MAP2A and MAP2B, which are known as high molecular weight (HMW) isoforms, run as ~280 kDa species, while low molecular weight (LMW) isoforms MAP2C and MAP2D are around ~70 kDa. MAP2 proteins are heavily phosphorylated, which contributes to a large discrepancy between their predicted and observed molecular weight in SDS-PAGE (220 vs 280 kDa for HMW forms).

What is the tissue expression pattern of MAP2? What is the subcellular localization of MAP2?

MAP2 isoforms differ in their tissue and developmental expression pattern (PMID: 2469170 and 3898077). In the brain, MAP2B is widely expressed during and post development, MAP2A is expressed postnatally, while MAP2C is present only in the early development except of present in photosensitive cells of the adult retina and in the olfactory system. MAP proteins are highly expressed in the CNS found in cell bodies and dendrites of neurons, in dorsal root ganglion, reactive glia, and in the testis (PMID: 9588626). In neurons, MAP2 proteins are found in the cell body and dendrites, where they associate with microtubules, while they can also be present in the nuclei of testicular cells.

Can MAP2 be used as a neuronal marker?

MAP2 proteins are abundantly expressed in neurons. MAP2 is frequently used as a dendritic marker because it is present in the cell body and dendrites of neurons but absent in axons (PMID: 28413822).


Protocols

Product Specific Protocols
FC protocol for MAP2 antibody 17490-1-APDownload protocol
IF protocol for MAP2 antibody 17490-1-APDownload protocol
IHC protocol for MAP2 antibody 17490-1-APDownload protocol
IP protocol for MAP2 antibody 17490-1-APDownload protocol
WB protocol for MAP2 antibody 17490-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Cell Stem Cell

In vivo reprogramming of NG2 glia enables adult neurogenesis and functional recovery following spinal cord injury.

Authors - Wenjiao Tai
humanIF

Cell Stem Cell

Recent Zika Virus Isolates Induce Premature Differentiation of Neural Progenitors in Human Brain Organoids.

Authors - Elke Gabriel
humanIF

Nat Commun

Reliability of high-quantity human brain organoids for modeling microcephaly, glioma invasion and drug screening

Authors - Anand Ramani
mouseIF

Nat Commun

Repair-associated macrophages increase after early-phase microglia attenuation to promote ischemic stroke recovery

Authors - Xiaotao Zhang
mouseWB,IF

Neuron

Astrocytic ApoE reprograms neuronal cholesterol metabolism and histone-acetylation-mediated memory.

Authors - Xiaohui Li
mouseIF

Sci Adv

Glioblastoma exploits ATP from leading-edge astrocytes to fuel its infiltrative growth revealed by spatially resolved chimeric analysis

Authors - Gaoxia Yang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Makenna (Verified Customer) (07-15-2024)

Antibody worked well for IF at a dilution of 1:500

  • Applications: Immunofluorescence
FH

Abigail (Verified Customer) (07-15-2024)

Used for IF and got clear images in green and red channels.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Mouse brain cortex
FH

Reyes (Verified Customer) (04-05-2024)

MAP2 (in green) shows a strong marking of my neurons in human brain FFPE cortex

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Human Brain Cortex
MAP2 Antibody Immunofluorescence validation (1:100 dilution) in Human Brain Cortex (Cat no:17490-1-AP)
FH

Filipa (Verified Customer) (09-18-2023)

I used this anti-MAP2 antibody at 1:200 dilution for IF. The cells were fixed in 4% PFA in PBS for 20 minutes, and incubated with the primary antibody for 3 hours at RT. MAP2 staining works very well at this dilution.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: primary rat hippocampal neurons
MAP2 Antibody Immunofluorescence validation (1:200 dilution) in primary rat hippocampal neurons (Cat no:17490-1-AP)
FH

BING (Verified Customer) (08-04-2021)

suitable for detection of both bands of MAP2 by WB with one above 250 kd

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: primary cortical neuron lysate
MAP2 Antibody Western Blot validation (1:1000 dilution) in primary cortical neuron lysate (Cat no:17490-1-AP)
FH

Dipen (Verified Customer) (07-20-2020)

Not great for Western blotting.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Hippocampal neurons
MAP2 Antibody Western Blot, validation (1:500 dilution) in Hippocampal neurons (Cat no:17490-1-AP)
FH

Naomi (Verified Customer) (03-09-2020)

I used the rabbit polyclonal anti-MAP2 antibody at 1:500 dilution to in differentiated PC-12 cells. The cells were fixed in 4% PFA in PBS for 12 minutes. 1 hr in blocking buffer, followed by 24 h incubation in primary antibody. MAP2 was expressed in neurites. Works well at this dilution, great images.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: PC-12
FH

Gloria (Verified Customer) (01-30-2020)

Beautiful staining in primary hippocampal and cortical neurons.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:250 dilution
  • Cell Tissue Type: Primary hippocampal and cortical neurons
MAP2 Antibody Immunofluorescence, validation (1:250 dilution dilution) in Primary hippocampal and cortical neurons (Cat no:17490-1-AP)
FH

Ricky (Verified Customer) (02-22-2019)

1:5000 dilution is good enough for a clear and sharp image of western blot. I am now using Li-Cor's Odyssey CLX imaging systems . The second antibody is from Li-Cor with 1:5000 dilution. By the way, I also tried to use 1:1000 dilution for my low expression samples, and there was no bad noise backgrounds.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: HEK293
Loading...
||
New chat

Able

正在加载,请稍候...