• Featured Product
  • KD/KO Validated

MAPK11 Polyclonal antibody

MAPK11 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 17376-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

MAP kinase 11, MAP kinase p38 beta, MAPK 11, MAPK11, p38 2, P38B, p38Beta, P38BETA2, PRKM11, SAPK2, SAPK2B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, human heart tissue, mouse skeletal muscle tissue
Positive IHC detected inhuman brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17376-1-AP targets MAPK11 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11184

Product name: Recombinant human MAPK11 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-364 aa of BC027933

Sequence: MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ

Predict reactive species
Full Name mitogen-activated protein kinase 11
Calculated Molecular Weight 364 aa, 41 kDa
Observed Molecular Weight 42 kDa
GenBank Accession NumberBC027933
Gene Symbol MAPK11
Gene ID (NCBI) 5600
RRIDAB_2297482
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15759
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MAPK11(Mitogen-activated protein kinase 11) is also named as PRKM11, SAPK2, SAPK2B,p38b and belongs to the MAP kinase subfamily.It is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as proinflammatory cytokines or physical stress leading to direct activation of transcription factors.In mouse brain, both p38a and p38b are present in neurons, while p38b is also expressed in glial cells(PMID:15748168).

Protocols

Product Specific Protocols
IF protocol for MAPK11 antibody 17376-1-APDownload protocol
IHC protocol for MAPK11 antibody 17376-1-APDownload protocol
WB protocol for MAPK11 antibody 17376-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Theranostics

Interleukin 33-mediated inhibition of A-type K+ channels induces sensory neuronal hyperexcitability and nociceptive behaviors in mice.

Authors - Yiru Wang
humanWB

Mol Pharmacol

p38β MAPK signaling mediates exenatide-stimulated microglial β-endorphin expression.

Authors - Hai-Yun Wu
  • KD Validated
humanWB,IHC

Tumour Biol

Clinicopathological significance of p38β, p38γ, and p38δ and its biological roles in esophageal squamous cell carcinoma.

Authors - Shutao Zheng
  • KD Validated
ratWB

BMC Endocr Disord

The role of MAPK11/12/13/14 (p38 MAPK) protein in dopamine agonist-resistant prolactinomas.

Authors - Shuman Wang
  • KD Validated
WB

J Hazard Mater

Metastatic effects of environmental carcinogens mediated by MAPK and UPR pathways with an in vivo Drosophila Model

Authors - Fangnon Firmin Fangninou
mouseWB

Nat Microbiol

ERK pathway reactivation prevents anthrax toxin lethality in mice

Authors - Jie Liu
Loading...
||
New chat Able
正在加载,请稍候...