Use Able AI chat for product recommendations

MRPS22 Polyclonal antibody

MRPS22 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

C3orf5, COXPD5, GIBT, GK002, MRP S22

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for MRPS22 in ?

Tested Applications

Positive WB detected inJurkat cells, THP-1 cells, mouse liver tissue, rat liver tissue
Positive IP detected inJurkat cells
Positive IHC detected inhuman breast cancer tissue, rat colon tissue, human colon cancer tissue, rat pancreas tissue, human placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10984-1-AP targets MRPS22 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1421

Product name: Recombinant human MRPS22 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-360 aa of BC009296

Sequence: MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQEALSRHSAAS

Predict reactive species
Full Name mitochondrial ribosomal protein S22
Calculated Molecular Weight 41 kDa
Observed Molecular Weight 38 kDa
GenBank Accession NumberBC009296
Gene Symbol MRPS22
Gene ID (NCBI) 56945
RRIDAB_2146488
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP82650
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MRPS22, also named as C3orf5, RPMS22 and S22mt, is a component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins. Defects in MRPS22 are the cause of combined oxidative phosphorylation deficiency type 5 (COXPD5). MRPS22 is a 360-amino-acid protein that has been found in a limited number of species, having no ortholog in fungi or prokaryotes. The exact location of MRPS22 in the three dimensional structure of the ribosome and its exact function are currently unknown. Recently, a MRPS22 defect was shown to strongly hamper assembly of the small ribosomal subunit, whereas assembly of the large subunit and part of the small subunit were only mildly affected.(PMID:21189481)

Protocols

Product Specific Protocols
IHC protocol for MRPS22 antibody 10984-1-APDownload protocol
IP protocol for MRPS22 antibody 10984-1-APDownload protocol
WB protocol for MRPS22 antibody 10984-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-GRSF1 (p32/gC1qR) antibody, catalog number 10984-1-AP, has 27 total citations published in journals including Cell Metabolism, Nucleic Acids Research, Nature Structural & Molecular Biology, Cell Reports, JCI Insight, EMBO Reports, Scientific Reports, iScience, FEBS Journal, PLoS Genetics, Human Molecular Genetics, PLoS ONE, and bioRxiv. Associated research fields include mitochondrial ribosome assembly, mitochondrial translation, posttranscriptional gene expression, RNA granules, mtDNA replication, and mitochondrial disease.

SpeciesApplicationTitle
humanWB

Cell Metab

The mitochondrial RNA-binding protein GRSF1 localizes to RNA granules and is required for posttranscriptional mitochondrial gene expression.

Authors - Antonicka Hana H
mouseWB

Cell Metab

MARIGOLD and MitoCIAO, two searchable compendia to visualize and functionalize protein complexes during mitochondrial remodeling

Authors - Giovanni Rigoni
mouse,humanWB

Nucleic Acids Res

p32/gC1qR is indispensable for fetal development and mitochondrial translation: importance of its RNA-binding ability.

Authors - Yagi Mikako M
humanWB

Nucleic Acids Res

Mitochondrial RNA granules are critically dependent on mtDNA replication factors Twinkle and mtSSB.

Authors - Fenna Hensen
humanWB

Nucleic Acids Res

C7orf30 specifically associates with the large subunit of the mitochondrial ribosome and is involved in translation.

Authors - Wanschers Bas F J BF
humanWB

Nucleic Acids Res

MPV17L2 is required for ribosome assembly in mitochondria.

Authors - Ilaria Dalla Rosa
Loading...
||
New chat

Able™

正在加载,请稍候...