MRPS22 Polyclonal antibody

MRPS22 Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 10984-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

C3orf5, COXPD5, GIBT, GK002, MRP S22

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, rat spleen tissue, mouse liver tissue, mouse spleen tissue
Positive IP detected inJurkat cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 23 publications below

Product Information

10984-1-AP targets MRPS22 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1421

Product name: Recombinant human MRPS22 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-360 aa of BC009296

Sequence: MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQEALSRHSAAS

Predict reactive species
Full Name mitochondrial ribosomal protein S22
Calculated Molecular Weight 41 kDa
Observed Molecular Weight 38 kDa
GenBank Accession NumberBC009296
Gene Symbol MRPS22
Gene ID (NCBI) 56945
RRIDAB_2146488
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP82650
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MRPS22, also named as C3orf5, RPMS22 and S22mt, is a component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins. Defects in MRPS22 are the cause of combined oxidative phosphorylation deficiency type 5 (COXPD5). MRPS22 is a 360-amino-acid protein that has been found in a limited number of species, having no ortholog in fungi or prokaryotes. The exact location of MRPS22 in the three dimensional structure of the ribosome and its exact function are currently unknown. Recently, a MRPS22 defect was shown to strongly hamper assembly of the small ribosomal subunit, whereas assembly of the large subunit and part of the small subunit were only mildly affected.(PMID:21189481)

Protocols

Product Specific Protocols
IHC protocol for MRPS22 antibody 10984-1-APDownload protocol
IP protocol for MRPS22 antibody 10984-1-APDownload protocol
WB protocol for MRPS22 antibody 10984-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Metab

The mitochondrial RNA-binding protein GRSF1 localizes to RNA granules and is required for posttranscriptional mitochondrial gene expression.

Authors - Antonicka Hana H
humanWB

Cell Rep

The Human Mitochondrial DEAD-Box Protein DDX28 Resides in RNA Granules and Functions in Mitoribosome Assembly.

Authors - Ya-Ting Tu
humanWB

PLoS Genet

Mutations in the UQCC1-Interacting Protein, UQCC2, Cause Human Complex III Deficiency Associated with Perturbed Cytochrome b Protein Expression.

Authors - Elena J Tucker
humanWB

Nucleic Acids Res

Replication factors transiently associate with mtDNA at the mitochondrial inner membrane to facilitate replication.

Authors - Nina Rajala
humanWB

Nucleic Acids Res

MPV17L2 is required for ribosome assembly in mitochondria.

Authors - Ilaria Dalla Rosa
humanWB

Nucleic Acids Res

C7orf30 specifically associates with the large subunit of the mitochondrial ribosome and is involved in translation.

Authors - Wanschers Bas F J BF
Loading...
||
New chat Able
正在加载,请稍候...