Tested Applications
| Positive WB detected in | A431 cells, HeLa cells |
| Positive IP detected in | A431 cells |
| Positive IHC detected in | mouse brain tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17280-1-AP targets MRPS27 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11047 Product name: Recombinant human MRPS27 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-168 aa of BC030521 Sequence: MPLIWKPGYLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGASEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA Predict reactive species |
| Full Name | mitochondrial ribosomal protein S27 |
| Calculated Molecular Weight | 168 aa, 19 kDa, 48 kDa |
| Observed Molecular Weight | 48 kDa |
| GenBank Accession Number | BC030521 |
| Gene Symbol | MRPS27 |
| Gene ID (NCBI) | 23107 |
| RRID | AB_2180510 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92552 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Genes encoding PPR (pentatricopeptide repeat)-containing proteins constitute one of the largest gene families in plants. The majority of these proteins are predicted to target organelles and to bind to RNA. Strikingly, there is a dearth of these proteins in mammals, although genomic searches reveal six candidates, all of which are also predicted to target the mitochondrion. One of these proteins, MRPS27is participated in transcription and translation respectively. [PMID:18939947] MRPS27is a component of the small subunit of the mitochondrial ribosome that is encoded by the nuclear genome [PMID: 11279123].
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MRPS27 antibody 17280-1-AP | Download protocol |
| IHC protocol for MRPS27 antibody 17280-1-AP | Download protocol |
| IP protocol for MRPS27 antibody 17280-1-AP | Download protocol |
| WB protocol for MRPS27 antibody 17280-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-POLRMT (mtRNA Polymerase), catalog #17280-1-AP, has 33 total citations published in journals including Nature Communications, Nucleic Acids Research, PNAS, Cell Reports, Journal of Clinical Investigation, Science Advances, Cell Death & Differentiation, and EMBO Molecular Medicine. Research fields span mitochondrial biology, mitoribosome biogenesis, mitochondrial protein synthesis, RNA processing, oxidative phosphorylation, cancer, and neurogenetics.
| Species | Application | Title |
|---|---|---|
Cell Metab The mitochondrial RNA-binding protein GRSF1 localizes to RNA granules and is required for posttranscriptional mitochondrial gene expression. | ||
Nat Commun RNA modification landscape of the human mitochondrial tRNALys regulates protein synthesis. | ||
Nucleic Acids Res Transcription-independent role for human mitochondrial RNA polymerase in mitochondrial ribosome biogenesis. | ||
Reviews
What customers say
The product has one verified review. A researcher used it at a 1:1000 dilution for Western Blot on C2C12 cell lysates (RIPA buffer) and awarded a perfect 5-star rating. The reviewer confirmed successful detection with clean results, indicating reliable performance for WB applications on this cell line.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Xhuljana (Verified Customer) (03-01-2024) | WB in ripa lysate C2C12 cells
 |
