Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

MRPS27 Polyclonal antibody

MRPS27 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

KIAA0264, MRP S27, MRPS 27, MRP-S27, S27mt

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for MRPS27 in ?

Tested Applications

Positive WB detected inA431 cells, HeLa cells
Positive IP detected inA431 cells
Positive IHC detected inmouse brain tissue, human kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17280-1-AP targets MRPS27 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11047

Product name: Recombinant human MRPS27 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-168 aa of BC030521

Sequence: MPLIWKPGYLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGASEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA

Predict reactive species
Full Name mitochondrial ribosomal protein S27
Calculated Molecular Weight 168 aa, 19 kDa, 48 kDa
Observed Molecular Weight 48 kDa
GenBank Accession NumberBC030521
Gene Symbol MRPS27
Gene ID (NCBI) 23107
RRIDAB_2180510
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ92552
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Genes encoding PPR (pentatricopeptide repeat)-containing proteins constitute one of the largest gene families in plants. The majority of these proteins are predicted to target organelles and to bind to RNA. Strikingly, there is a dearth of these proteins in mammals, although genomic searches reveal six candidates, all of which are also predicted to target the mitochondrion. One of these proteins, MRPS27is participated in transcription and translation respectively. [PMID:18939947] MRPS27is a component of the small subunit of the mitochondrial ribosome that is encoded by the nuclear genome [PMID: 11279123].

Protocols

Product Specific Protocols
IF protocol for MRPS27 antibody 17280-1-APDownload protocol
IHC protocol for MRPS27 antibody 17280-1-APDownload protocol
IP protocol for MRPS27 antibody 17280-1-APDownload protocol
WB protocol for MRPS27 antibody 17280-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-POLRMT (mtRNA Polymerase), catalog #17280-1-AP, has 33 total citations published in journals including Nature Communications, Nucleic Acids Research, PNAS, Cell Reports, Journal of Clinical Investigation, Science Advances, Cell Death & Differentiation, and EMBO Molecular Medicine. Research fields span mitochondrial biology, mitoribosome biogenesis, mitochondrial protein synthesis, RNA processing, oxidative phosphorylation, cancer, and neurogenetics.

SpeciesApplicationTitle
humanWB

Cell Metab

The mitochondrial RNA-binding protein GRSF1 localizes to RNA granules and is required for posttranscriptional mitochondrial gene expression.

Authors - Antonicka Hana H
humanWB

Nat Commun

RNA modification landscape of the human mitochondrial tRNALys regulates protein synthesis.

Authors - Uwe Richter
humanWB

Nucleic Acids Res

Transcription-independent role for human mitochondrial RNA polymerase in mitochondrial ribosome biogenesis.

Authors - Surovtseva Yulia V YV
humanWB

Nucleic Acids Res

The human Obg protein GTPBP10 is involved in mitoribosomal biogenesis.

Authors - Elena Lavdovskaia
humanWB,IF

Nucleic Acids Res

MPV17L2 is required for ribosome assembly in mitochondria.

Authors - Ilaria Dalla Rosa
humanWB

Nucleic Acids Res

A bifunctional protein regulates mitochondrial protein synthesis.

Authors - Tara R Richman

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The product has one verified review. A researcher used it at a 1:1000 dilution for Western Blot on C2C12 cell lysates (RIPA buffer) and awarded a perfect 5-star rating. The reviewer confirmed successful detection with clean results, indicating reliable performance for WB applications on this cell line.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Xhuljana (Verified Customer) (03-01-2024)

WB in ripa lysate C2C12 cells

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: C2C12 cells
MRPS27 Antibody Western Blot validation (1:1000 dilution) in C2C12 cells (Cat no:17280-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...