Tested Applications
| Positive WB detected in | HEK-293 cells, HuH-7 cells, human brain tissue, K-562 cells, mouse kidney tissue, MCF-7 cells |
| Positive IP detected in | mouse kidney tissue |
| Positive IHC detected in | human liver cancer tissue, human colon cancer tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10794-1-AP targets MTHFD1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1225 Product name: Recombinant human MTHFD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 536-935 aa of BC009806 Sequence: TNDRFLRKITIGQAPTEKGHTRTAQFDISVASEIMAVLALTTSLEDMRERLGKMVVASSKKGEPVSAEDLGVSGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSIIADQIALKLVGPEGFVVTEAGFGADIGMEKFFNIKCRYSGLCPHVVVLVATVRALKMHGGGPTVTAGLPLPKAYIQENLELVEKGFSNLKKQIENARMFGIPVVVAVNAFKTDTESELDLISRLSREHGAFDAVKCTHWAEGGKGALALAQAVQRAAQAPSSFQLLYDLKLPVEDKIRIIAQKIYGADDIELLPEAQHKAEVYTKQGFGNLPICMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTMPGLPTRPCFYDIDLDPETEQVNGLF Predict reactive species |
| Full Name | methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1, methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthetase |
| Calculated Molecular Weight | 101 kDa |
| Observed Molecular Weight | 101 kDa |
| GenBank Accession Number | BC009806 |
| Gene Symbol | MTHFD1 |
| Gene ID (NCBI) | 4522 |
| RRID | AB_2147391 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P11586 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MTHFD1 is a trifunctional enzyme involved in the pathway tetrahydrofolate interconversion, which is part of One-carbon metabolism. MTHFD1 is associated with HCC and CRC progression. It has been reported that MTHFD-deficient patient fibroblasts exhibit enriched MTHFD1 in the nucleus which is critical for de novo dTMP synthesis.(PMID: 31133746, 30997850, 31421459, 25548164)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MTHFD1 antibody 10794-1-AP | Download protocol |
| IHC protocol for MTHFD1 antibody 10794-1-AP | Download protocol |
| IP protocol for MTHFD1 antibody 10794-1-AP | Download protocol |
| WB protocol for MTHFD1 antibody 10794-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The MTHFD1 Polyclonal antibody (Cat# 10794-1-AP) has 21 citations published in journals including Nature, Nature Communications, Molecular Cell, PNAS, Cell Death & Disease, Redox Biology, Developmental Cell, Journal of Medicinal Chemistry, Cancer Metabolism, Molecular Oncology, Scientific Reports, Journal of Virology, and others. Associated research fields encompass one-carbon/folate metabolism, NADPH redox biology, cancer (melanoma, glioblastoma, neuroblastoma, AML), vascular aging, fibrosis, antiviral mechanisms, and cardiac metabolism.
| Species | Application | Title |
|---|---|---|
Nat Commun Mitochondrial one-carbon metabolism is required for TGF-β-induced glycine synthesis and fibrotic responses.
| ||
Nat Commun Elevating cytosolic NADPH metabolism in endothelial cells ameliorates vascular aging. | ||
Nat Commun Native chromatome profiling reveals hundreds of metabolic enzymes in the nucleus across tissues. | ||
Redox Biol Cytosolic ME1 integrated with mitochondrial IDH2 supports tumor growth and metastasis. | ||
Mol Cell Accumulation of succinate suppresses de novo purine synthesis through succinylation-mediated control of the mitochondrial folate cycle. |
Reviews
What customers say
Both reviewers used this antibody for Western Blot and reported positive results. One user, working at a 1:1000 dilution with human cell lines, gave a 5-star rating, praising the antibody for producing clear signals with no background binding. The other user, testing at 1:500 dilution on liver, kidney, and hippocampus tissues, gave a 4-star rating and simply noted that it works well. Overall, the reviews indicate reliable performance in WB with minimal background, across both cell lines and tissue samples.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Lili (Verified Customer) (02-05-2026) | Great antibody. Works amazing, no background binding.
 |
Hua (Verified Customer) (08-26-2019) | Works well.
 |
