MYH10 Recombinant monoclonal antibody

MYH10 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, ELISA
Cat No. 86157-3-RR
Clone No.250791D5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Myosin 10, Myosin heavy chain 10, Myosin heavy chain, non-muscle IIb, Myosin-10, NMMHC II-b

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293T cells, mouse cerebellum tissue, NIH/3T3 cells, mouse brain tissue, rat brain tissue, rat cerebellum tissue
Positive IHC detected inmouse cerebellum tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse cerebellum tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86157-3-RR targets MYH10 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag16113

Product name: Recombinant human MYH10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1183-1322 aa of BC150634

Sequence: QEVAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKASKLQNELDNVSTLLEEAEKKGIKFAKDAASL

Predict reactive species
Full Name myosin, heavy chain 10, non-muscle
Calculated Molecular Weight 1985 aa, 230 kDa
Observed Molecular Weight 229 kDa
GenBank Accession NumberBC150634
Gene Symbol MYH10
Gene ID (NCBI) 4628
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP35580
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MYH10 (non-muscle II-b, NM IIB) is a member of non-muscle myosin II which plays fundamental roles in the maintenance of cell morphology, cell adhesion, and migration, as well as cell division. MYH10 is mainly present in nerve cells, megakaryocytes, and other non-muscle cells. It has been reported to mediate centrosome reorientation during cell migration and contribute to ciliogenesis. Overexpression of MYH10 has been observed in breast cancer.

Protocols

Product Specific Protocols
IF protocol for MYH10 antibody 86157-3-RRDownload protocol
IHC protocol for MYH10 antibody 86157-3-RRDownload protocol
WB protocol for MYH10 antibody 86157-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...