Tested Applications
| Positive WB detected in | NTERA-2 cl.D1 cells |
| Positive IF/ICC detected in | human embronic stem cells |
| Positive FC (Intra) detected in | NCCIT cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14295-1-AP targets Nanog in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, pig, chicken, marmoset |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5645 Product name: Recombinant human NANOG protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-305 aa of BC160187 Sequence: MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV Predict reactive species |
| Full Name | Nanog homeobox |
| Calculated Molecular Weight | 35 kDa |
| Observed Molecular Weight | 42 kDa |
| GenBank Accession Number | BC160187 |
| Gene Symbol | Nanog |
| Gene ID (NCBI) | 79923 |
| RRID | AB_1607719 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H9S0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Nanog is a member of the homeobox family of DNA binding transcription factors and has been shown to maintain embryonic stem (ES) cell self-renewal independently of leukemia inhibitory factor (LIF)/Stat3. Nanog mRNA is present in pluripotent mouse and human cell lines, and absent from differentiated cells. Functionally, Nanog works together with other key pluripotent factors (Oct4, Sox2, and Lin28) to reprogram human fibroblasts and generate induced pluripotent stem (iPS) cells. These key factors form a regulatory network to support or limit each other's expression level, which maintains the properties of ES cells. Affinity purified rabbit anti-Nanog can be used to demonstrate pluripotency of ES and IPS cells. There are two kinds of variants that can be recognized by NANOG, one is a normal form (~39 kDa), the other is a post-translation modified form (~48 kDa) (21136380 ). Nanog has two isoforms with molecular weights of 34.4 kDa and 31.9 kDa. (PMID: 21969378)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Nanog antibody 14295-1-AP | Download protocol |
| WB protocol for Nanog antibody 14295-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-NANOG antibody (Cat# 14295-1-AP) has 356 total citations published in journals including Nature Genetics, Nature Communications, Cell Stem Cell, Molecular Cancer, EMBO Journal, Oncogene, Theranostics, Cell Death & Disease, and Advanced Science. Research fields encompass cancer stem cell biology, pluripotency, embryonic and induced pluripotent stem cell differentiation, mesenchymal stem cells, epithelial-mesenchymal transition, Wnt/β-catenin and Hedgehog signaling, and chemoresistance across lung, breast, liver, colorectal, and pancreatic cancers.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther WIP1 promotes cancer stem cell properties by inhibiting p38 MAPK in NSCLC. | ||
Mol Cancer Integrated single-cell and spatial transcriptomic profiling decodes lineage plasticity and immune microenvironment remodeling in prostate cancer progression. | ||
Mol Cancer Circular RNA circIPO11 drives self-renewal of liver cancer initiating cells via Hedgehog signaling. | ||
Mol Cancer Myeloid-derived suppressor cells endow stem-like qualities to multiple myeloma cells by inducing piRNA-823 expression and DNMT3B activation. | ||
Cancer Commun (Lond) PLEK2 promotes cancer stemness and tumorigenesis of head and neck squamous cell carcinoma via the c-Myc-mediated positive feedback loop | ||
Nat Genet A GGC-repeat expansion in ZFHX3 encoding polyglycine causes spinocerebellar ataxia type 4 and impairs autophagy |
Reviews
What customers say
All 6 reviewers rated this NANOG antibody 4–5 stars. It performed well in Western Blot and Immunofluorescence across diverse cell types including mESCs, human iPSCs, SKOV3, U2OS, and mouse primary cardiomyocytes. Recommended dilutions ranged from 1:50 (IF) to 1:8000 (WB), with overnight incubation at 4°C being common. Reviewers consistently praised its high specificity for detecting stemness markers in both cancer stem cells and embryonic stem cells.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Claudia (Verified Customer) (03-06-2026) | this antibody works well in my mESCs at 20µg with an overnight incubation
|
Cristine (Verified Customer) (11-09-2025) | The NANOG antibody worked very well and with high specificity at the dilution of 1:50 after overnight incubation at 4oC in immunocytochemistry assays of human induced pluripotent stem cells.
|
Chunxu (Verified Customer) (05-27-2025) | This antibody works very well in WB and IF to determine the stemness either cancer stem cells or mouse embryonic stem cells.
|
Fatemeh (Verified Customer) (05-22-2023) | 50 ug of protein lysate was used for WB. Blot was blocked with 5% milk and incubated with 1-1000 primary antibody overnight at 4C.
 |
Udesh (Verified Customer) (02-24-2023) | Worked well at 1:1000 in 5% BSA O/N at 4 degrees
 |
Ying (Verified Customer) (08-19-2019) | very good antibody.
|
