Tested Applications
| Positive WB detected in | HepG2 cells, L02 cells, HeLa cells, human placenta tissue |
| Positive IHC detected in | human liver cancer tissue, human stomach cancer tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27488-1-AP targets NDNL2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26663 Product name: Recombinant human NDNL2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC053999 Sequence: MLQKPRNRGRSGGQAERDRDWSHSGNPGASRAGEDARVLRDGFAEEAPSTSRGPGGSQGSQGPSPQGARRAQAAPAVGPRSQKQLELKVS Predict reactive species |
| Full Name | necdin-like 2 |
| Calculated Molecular Weight | 34 kDa |
| Observed Molecular Weight | 38 kDa |
| GenBank Accession Number | BC053999 |
| Gene Symbol | NDNL2 |
| Gene ID (NCBI) | 56160 |
| RRID | AB_2880885 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96MG7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NDNL2 (also known as NSMCE3 or MAGEG1) is a part of the SMC5-6 protein complex that is essential for DNA damage response and chromosome segregation (PMID: 18086888; 27427983). The gene of human NDNL2 maps to chromosome 15q13.1. Northern blot analysis detected expression of a 1.9-kb transcript in all human tissues tested, with highest expression in testis (PMID: 11782285). Missense mutations in NSMCE3 have been associated with an autosomal recessive chromosome breakage syndrome that leads to defective T and B cell function and acute respiratory distress syndrome in early childhood (PMID: 27427983).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NDNL2 antibody 27488-1-AP | Download protocol |
| IHC protocol for NDNL2 antibody 27488-1-AP | Download protocol |
| WB protocol for NDNL2 antibody 27488-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-SMC5 antibody (Cat# 27488-1-AP) has 2 total citations. These appear in International Journal of Biological Macromolecules (IF 8.7) and Cell Reports (IF 7.7). Both studies used the antibody for Western Blot in human samples and focused on the role of the SMC5/6 cohesin complex in viral biology—specifically HBV inhibition and Epstein-Barr virus replication evasion mechanisms.
| Species | Application | Title |
|---|---|---|
Cell Rep Epstein-Barr virus BNRF1 destabilizes SMC5/6 cohesin complexes to evade its restriction of replication compartments. |
