Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

P27; KIP1 Polyclonal antibody

P27; KIP1 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA

Cat No. 25614-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (4)

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, ELISA

CDKN1B, P27, CDKN4, Cyclin-dependent kinase inhibitor 1B, Cyclin-dependent kinase inhibitor p27

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, NIH/3T3 cells, HepG2 cells, MCF-7 cells, Jurkat cells, MDA-MB-231 cells
Positive IP detected inNIH/3T3 cells
Positive IHC detected inhuman breast cancer tissue, human lung cancer tissue, human colon cancer tissue, human ovary tumor tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse testis tissue
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25614-1-AP targets P27; KIP1 in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, canine, bovine, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag22582

Product name: Recombinant human P27; KIP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 44-198 aa of BC001971

Sequence: DLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDGSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT

Predict reactive species
Full Name cyclin-dependent kinase inhibitor 1B (p27, Kip1)
Calculated Molecular Weight 198 aa, 22 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC001971
Gene Symbol p27 Kip1/CDKN1B
Gene ID (NCBI) 1027
RRIDAB_2880161
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP46527
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CDKN1B, also named as P27 or KIP1, is a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. P27 binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controlling cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. Downregulation of P27 has been implicated in the progression of several malignancies, including lung cancer, hepatocellular carcinoma, salivary cancer, oral squamous cell carcinomas, and gastric cancer.

Protocols

Product Specific Protocols
FC protocol for P27; KIP1 antibody 25614-1-APDownload protocol
IF protocol for P27; KIP1 antibody 25614-1-APDownload protocol
IHC protocol for P27; KIP1 antibody 25614-1-APDownload protocol
IP protocol for P27; KIP1 antibody 25614-1-APDownload protocol
WB protocol for P27; KIP1 antibody 25614-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB,IHC

Gastroenterology

Intestinal PPARα Protects Against Colon Carcinogenesis via Regulation of Methyltransferases DNMT1 and PRMT6.

Authors - Yuhong Luo
mouseWB

Nat Commun

Foxk1 and Foxk2 promote cardiomyocyte proliferation and heart regeneration

Authors - Dongcheng Cai
humanWB

Cell Res

DNA damage triggers tubular endoplasmic reticulum extension to promote apoptosis by facilitating ER-mitochondria signaling.

Authors - Pengli Zheng
humanWB

Mol Cancer

LncRNA TROJAN promotes proliferation and resistance to CDK4/6 inhibitor via CDK2 transcriptional activation in ER+ breast cancer.

Authors - Xi Jin
humanWB

Mol Cancer

CircGPR137B/miR-4739/FTO feedback loop suppresses tumorigenesis and metastasis of hepatocellular carcinoma.

Authors - Lianyong Liu
humanWB

Acta Pharm Sin B

SAE1 promotes tumor cell malignancy via SUMOylation and liquid-liquid phase separation facilitated nuclear export of p27

Authors - Ling Wang

Reviews

    4.3 out of 5
Add a review

3 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Malak (Verified Customer) (04-22-2021)

The optimal incubation period is 1.5 hr at room temperature. Avoid incubating the antibody overnight as it may result in aspecific signals.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/2000
  • Cell Tissue Type: Hepatic cancer cell extract

Susmita (Verified Customer) (09-17-2020)

Antibody is working very good for WB

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000 WB;

Joshua (Verified Customer) (07-27-2019)

Cells fixed in 4% paraformaldehyde and stained at 4C overnight. Decent staining with some background in rabbit cells. Nuclear localization as expected.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Rabbit Corneal Epithelial Cells
P27; KIP1 Antibody Immunofluorescence, validation (1:500 dilution) in Rabbit Corneal Epithelial Cells (Cat no:25614-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...