Use Able AI chat for product recommendations

PCYT1B/PCYT1A Polyclonal antibody

PCYT1B/PCYT1A Polyclonal Antibody for WB, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

PCYT1B, CCT B, CCT beta, CCTB, CCT-beta

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for PCYT1B/PCYT1A in ?

Tested Applications

Positive WB detected inLNCaP cells, human brain tissue
Positive IP detected inhuman placenta tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13765-1-AP targets PCYT1B/PCYT1A in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4748

Product name: Recombinant human PCYT1B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-351 aa of BC045634

Sequence: MVGNQECIMEEDNRAPQLWRKTLTAPAPFADETNCQCQAPHEKLTIAQARLGTPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKRYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAWKQMFQERSSRMLQALSPKQSPVSSPTRSRSPSRSPSPTFSWLPLKTSPPSSPKAASASISSMSEGDEDEK

Predict reactive species
Full Name phosphate cytidylyltransferase 1, choline, beta
Calculated Molecular Weight 351 aa, 40 kDa
Observed Molecular Weight 42 kDa
GenBank Accession NumberBC045634
Gene Symbol PCYT1B
Gene ID (NCBI) 9468
RRIDAB_10642953
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y5K3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PCYT1B (Phosphate Cytidylyltransferase 1B, Choline), also named as CTβ, CCTB and CCT-Beta, is encoded by the gene belongs to the cytidylyltransferase family. It is involved in the regulation of phosphatidylcholine biosynthesis. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. PCYT1B encodes three isoforms of CTβ (CTβ1, CTβ2 and CTβ3). CTβ1, CTβ2 isoforms are present in humans and CTβ2 and CTβ3 isoforms have been identified in mice. The CTβ2 can be detected as 41 kDa, and CTβ3 can be detected as 39 kDa. This antibody can recognizes both PCYT1A and PCYT1B. PCYT1A usually exists in the form of a 80 kDa dimer.

Protocols

Product Specific Protocols
IP protocol for PCYT1B/PCYT1A antibody 13765-1-APDownload protocol
WB protocol for PCYT1B/PCYT1A antibody 13765-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The PCYT1B/PCYT1A Polyclonal antibody (Cat# 13765-1-AP) has 1 citation. It appears in Neurobiology of Disease, a study exploring choline metabolism in inflammatory bowel disease-linked anxiety disorders via multi-omics analysis of the gut-brain axis. The associated research fields include neurobiology, metabolic regulation, and gastrointestinal disease.

SpeciesApplicationTitle
mouseWB

Neurobiol Dis

Choline metabolism in regulating inflammatory bowel disease-linked anxiety disorders: A multi-omics exploration of the gut-brain axis

Authors - Fan Zhang

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

One customer rated this antibody 4 out of 5 stars. The reviewer used it at a 1:4000 dilution on mouse liver tissue for Western Blot and reported a strong signal, describing it as a good antibody for WB. Overall, the feedback is positive regarding its performance in Western Blot applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Hua (Verified Customer) (10-22-2025)

Good antibody for WB. Strong signal.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:4000
  • Cell Tissue Type: Mouse liver
PCYT1B/PCYT1A Antibody Western Blot validation (1:4000 dilution) in Mouse liver (Cat no:13765-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...