PRDX1 Recombinant monoclonal antibody

PRDX1 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 86589-2-RR
Clone No.251425B2

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

EC:1.11.1.24, MSP23, Natural killer cell-enhancing factor A, NKEF-A, PAG

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inK-562 cells, Jurkat cells, A549 cells, HSC-T6 cells, rat kidney tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86589-2-RR targets PRDX1 in WB, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag8602

Product name: Recombinant human PRDX1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-199 aa of BC007063

Sequence: MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Predict reactive species
Full Name peroxiredoxin 1
Calculated Molecular Weight 199 aa, 22 kDa
Observed Molecular Weight23 kDa
GenBank Accession NumberBC007063
Gene Symbol PRDX1
Gene ID (NCBI) 5052
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ06830
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRDX1 (Peroxiredoxin-1), also named as PAGA, PAGB, TDPX2, PAG or NKEF-A, belongs to the ahpC/TSA family. PRDX1 is a thiol reductase that plays critical roles in oxidative and thermal stress defense mechanisms through its abilities to metabolize H2O2 and act as a molecular chaperone, respectively. PRDX1 might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2 (PMID: 9497357). It reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation. PRDX1 can form a dimer, and also can be phosphorylated on Thr-90 during the M-phase, which leads to a more than 80% decrease in enzymatic activity (PMID: 22583657, 11986303).

Loading...
||
New chat

Able

正在加载,请稍候...