• Featured Product
  • KD/KO Validated

PTN Polyclonal antibody

PTN Polyclonal Antibody for ELISA
Cat No. 10821-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

HARP, HB GAM, HBBM, HBGF 8, HBGF8, HBNF, HBNF 1, HBNF1, Heparin binding brain mitogen, NEGF1, OSF 1, Osteoblast specific factor 1, pleiotrophin, PTN

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

10821-1-AP targets PTN in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1151

Product name: Recombinant human PTN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-168 aa of BC005916

Sequence: MQAQQYQQQRRKFAAAFLAFIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD

Predict reactive species
Full Name pleiotrophin
Calculated Molecular Weight 18 kDa
GenBank Accession NumberBC005916
Gene Symbol PTN
Gene ID (NCBI) 5764
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP21246
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Publications

SpeciesApplicationTitle
humanWB,IHC

Kidney Int

Pleiotrophin triggers inflammation and increased peritoneal permeability leading to peritoneal fibrosis.

Authors - Yokoi Hideki H
  • KO Validated
mouseWB

Angiogenesis

Pathogenic role and therapeutic potential of pleiotrophin in mouse models of ocular vascular disease.

Authors - Weiwen Wang
ratWB

Cell Physiol Biochem

N-Cadherin Maintains the Healthy Biology of Nucleus Pulposus Cells under High-Magnitude Compression.

Authors - Zhenyu Wang
humanWB

Int J Mol Med

High-glucose-based peritoneal dialysis solution induces the upregulation of VEGF expression in human peritoneal mesothelial cells: The role of pleiotrophin.

Authors - Liu Jia J

Cell Rep

NGPF2 triggers synaptic scaling up through ALK-LIMK-cofilin-mediated mechanisms.

Authors - Zikai Zhou
Loading...
||
New chat Able
正在加载,请稍候...