Tested Applications
| Positive WB detected in | A431 cells, A375 cells, human brain tissue, HeLa cells, MCF-7 cells, RAW 264.7 cells, mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human breast cancer tissue, human liver tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U-87 MG cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11329-2-AP targets RAB35 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, canine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1872 Product name: Recombinant human RAB35 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC015931 Sequence: MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC Predict reactive species |
| Full Name | RAB35, member RAS oncogene family |
| Calculated Molecular Weight | 201 aa, 23 kDa |
| Observed Molecular Weight | 23 kDa |
| GenBank Accession Number | BC015931 |
| Gene Symbol | RAB35 |
| Gene ID (NCBI) | 11021 |
| RRID | AB_2238179 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15286 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RAB35 is a member of the small GTPase superfamily. Like the other Rab proteins, RAB35 has 2 consecutive cysteine residues at its C terminus, and this region is thought to be involved in membrane association. Rab35 is found on the cell surface and endosomes, where it has been proposed to play a role in recycling of the transferrin and other receptors.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RAB35 antibody 11329-2-AP | Download protocol |
| IHC protocol for RAB35 antibody 11329-2-AP | Download protocol |
| IP protocol for RAB35 antibody 11329-2-AP | Download protocol |
| WB protocol for RAB35 antibody 11329-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RAB35 Polyclonal antibody (catalog number 11329-2-AP) has 56 citations. These appear in journals including Science, Cell Metabolism, Immunity, Nature Cell Biology, Nature Neuroscience, Nature Communications, Neuron, Science Advances, EMBO Journal, Cell Reports, PLoS Biology, Journal of Cell Science, Journal of Biological Chemistry, Traffic, and Oncotarget. Research fields span vesicular trafficking, endocytosis/exocytosis, exosome and extracellular vesicle biology, autophagy, neurodegeneration (Parkinson's, Alzheimer's, LRRK2), cancer, lipid metabolism, and cell migration.
| Species | Application | Title |
|---|---|---|
Cell Metab Oligodendrocytes Provide Antioxidant Defense Function for Neurons by Secreting Ferritin Heavy Chain. | ||
Immunity Modulation of the mevalonate pathway by TCR engagement regulates T follicular helper cell generation in homeostasis and autoimmunity.
| ||
Nat Cell Biol Protein kinase N controls a lysosomal lipid switch to facilitate nutrient signalling via mTORC1. | ||
Reviews
What customers say
All three reviews rate this Rab35 antibody 5 stars for Western Blot. Users tested it on human postmortem brain lysate, HEK293T cells, and mouse brain cortex at dilutions of 1:1000–1:2000. One reviewer highlighted it as a clean antibody detecting Rab35 at the correct molecular weight. Another described overnight incubation at 4 °C with 5% BSA blocking, confirming reliable signal. Overall, reviewers report specific, clean bands across multiple species and sample types with no notable issues.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Xin (Verified Customer) (03-15-2022) | A clean antibody to probe Rab35 with the right MW.
 |
Tom (Verified Customer) (02-24-2021) | HEK293T whole cell lysate probed with Rab35 antibody overnight at 4 degrees. Membrane was blocked in 5% BSA for one hour prior to incubation with antibody.
 |
Mayur (Verified Customer) (01-14-2019) |
 |
