Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

RAD52 Polyclonal antibody

RAD52 Polyclonal Antibody for WB, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IP, CoIP, ELISA

DNA repair protein RAD52 homolog

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for RAD52 in ?

Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, HL-60 cells, HepG2 cells
Positive IP detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:5000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28045-1-AP targets RAD52 in WB, IP, CoIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27619

Product name: Recombinant human RAD52 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 234-418 aa of NM_001297419

Sequence: MADQDCSSRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHSTPVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLALNNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS

Predict reactive species
Full Name RAD52 homolog (S. cerevisiae)
Calculated Molecular Weight 46 aa
Observed Molecular Weight 46-50 kDa
GenBank Accession NumberNM_001297419
Gene Symbol RAD52
Gene ID (NCBI) 5893
RRIDAB_2881046
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP43351
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IP protocol for RAD52 antibody 28045-1-APDownload protocol
WB protocol for RAD52 antibody 28045-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The RAD52 Polyclonal antibody (Cat# 28045-1-AP) has 9 citations published in Signal Transduction and Targeted Therapy, Nature Communications, Molecular Cell, Science Advances, Cell Death & Disease, Cell Reports, Frontiers in Pharmacology, Journal of Cellular and Molecular Medicine, and International Journal of Biochemistry and Cell Biology. Research fields span DNA repair, homologous recombination, cancer biology (hepatocellular, colon, ovarian, breast, and lung cancers), telomere maintenance, RNA splicing, and CRISPR/Cas9-mediated gene editing.

SpeciesApplicationTitle
humanWB,CoIP

Signal Transduct Target Ther

KAT2A-driven succinylation of SRSF11 enforces spliceosome-mediated RAD52 splicing to promote homologous recombination and radioresistance in hepatocellular carcinoma

Authors - Jun Wu
  • KD Validated
humanWB

Nat Commun

Pathway choice in the alternative telomere lengthening in neoplasia is dictated by replication fork processing mediated by EXD2's nuclease activity

Authors - Ronan Broderick
  • KD Validated
WB

Mol Cell

EXO1 protects BRCA1-deficient cells against toxic DNA lesions

Authors - Bert van de Kooij
humanWB

Sci Adv

Deficiency in mammalian STN1 promotes colon cancer development via inhibiting DNA repair

Authors - Dinh Duc Nguyen
humanWB

Cell Death Dis

SF3B4 promotes ovarian cancer progression by regulating alternative splicing of RAD52.

Authors - Yuchao Diao
  • KD Validated

Cell Rep

ABL kinase inactivation induces transcription-replication conflicts and impairs replication fork progression in metastatic small cell lung cancer.

Authors - Jing Jin Gu

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One user (Daniel U.) gave a 5-star rating for Western Blot using a 1:2000 dilution on HCT116 and RPE1 cells. They confirmed the antibody detected the expected ~48 kDa RAD52 band in wild-type cells but not in RAD52 knockout cells, validating its specificity.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Daniel (Verified Customer) (10-15-2024)

I detected the expected band for RAD52 and 48 kDa in WT cells, but not RAD52 KO cells, proving that the antibody is indeed recognizing RAD52.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: HCT116 and RPE1 cells
Loading...
||
New chat

Able™

正在加载,请稍候...