Featured Product
KD/KO Validated

RBP1 Polyclonal antibody

RBP1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 22683-1-AP

Publications (14)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Cellular retinol-binding protein, Cellular retinol-binding protein I, CRABP I, CRBP I, CRBP1

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICC

WB analysis using 22683-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 22683-1-AP (RBP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HEK-293 using 22683-1-AP
HEK-293 cells were subjected to SDS PAGE followed by western blot with 22683-1-AP (RBP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human brain using 22683-1-AP
human brain tissue were subjected to SDS PAGE followed by western blot with 22683-1-AP (RBP1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human liver using 22683-1-AP
human liver tissue were subjected to SDS PAGE followed by western blot with 22683-1-AP (RBP1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 22683-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 22683-1-AP (RBP1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 22683-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 22683-1-AP (RBP1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 22683-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 22683-1-AP (RBP1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 22683-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 22683-1-AP (RBP1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 22683-1-AP
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 22683-1-AP (RBP1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 22683-1-AP
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 22683-1-AP (RBP1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary using 22683-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary using 22683-1-AP (RBP1 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary using 22683-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary using 22683-1-AP (RBP1 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HEK-293 using 22683-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using RBP1 antibody (22683-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RBP1 in ?

Overview

Tested Applications
Product Information
Publications (14)
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse liver tissue, HEK-293 cells, human brain tissue, human liver tissue, rat liver tissue
Positive IHC detected in	human liver cancer tissue, human colon cancer tissue, human liver tissue, human ovary tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HEK-293 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunohistochemistry (IHC)	IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22683-1-AP targets RBP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag18572 Product name: Recombinant human RBP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-135 aa of BC121052 Sequence: MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ Predict reactive species
Full Name	retinol binding protein 1, cellular
Calculated Molecular Weight	135 aa, 16 kDa
Observed Molecular Weight	14-21 kDa
GenBank Accession Number	BC121052
Gene Symbol	RBP1
Gene ID (NCBI)	5947
RRID	AB_11182381
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P09455
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for RBP1 antibody 22683-1-AP	Download protocol
IHC protocol for RBP1 antibody 22683-1-AP	Download protocol
WB protocol for RBP1 antibody 22683-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-RBP1 (CRALBP) antibody, catalog number 22683-1-AP, has 14 total citations published in journals including Nature Communications, Metabolism, Cell Death & Disease, FASEB Journal, Journal of Biological Chemistry, J Transl Med, Mol Neurobiol, Transl Oncol, J Mol Cell Cardiol, Neural Regen Res, Brain Sci, J Food Biochem, Eur J Histochem, and Cell Commun Signal. Research fields span cancer biology, retinal degeneration, diabetes metabolism, cardiac hypertrophy, osteoarthritis, craniosynostosis, and vascular biology.

Species	Application	Title
		Nat Commun TGFβ-mediated dural progenitor cell migration into the coronal suture is crucial for preventing craniosynostosis. Authors - Peng Chen View Article
mouse	IHC	Metabolism Disruption of retinoid homeostasis induces RBP4 overproduction in diabetes: O-GlcNAcylation involved. Authors - Shyi-Jang Shin View Article
human	WB,IHC,IF	Cell Death Dis The RBP1-CKAP4 axis activates oncogenic autophagy and promotes cancer progression in oral squamous cell carcinoma. Authors - Ling Gao KD Validated View Article
human,mouse	WB,IHC	Cell Commun Signal In vivo CRISPR screening identifies POU3F3 as a novel regulator of ferroptosis resistance in hepatocellular carcinoma via retinoic acid signaling Authors - Yu Tian View Article
mouse	WB	J Transl Med Notch3 enhances the synergistic effect of all-trans retinoic acid and calcipotriol in pancreatic stellate cell activation Authors - Zheng Lian View Article
human	WB	Neural Regen Res AAV2-PDE6B restores retinal structure and function in the retinal degeneration 10 mouse model of retinitis pigmentosa by promoting phototransduction and inhibiting apoptosis Authors - Ruiqi Qiu View Article

Reviews

5.0 out of 5

Add a review

1 verified customer reviews

What customers say

One customer review was found for this product. Melissa García Caballero rated it 5 stars in June 2022, reporting successful use for both Western Blot and Immunofluorescence on endothelial cells at a 1:1 dilution (lot 00061710). Her brief comment stated that the antibody "worked out" as expected, indicating satisfactory performance in her applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

Melissa (Verified Customer) (06-13-2022)

We have used the antibody and it worked out