Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

RBP4 Polyclonal antibody

RBP4 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA

Plasma retinol binding protein, Plasma retinol-binding protein, Plasma retinol-binding protein(1-176), Plasma retinol-binding protein(1-179), Plasma retinol-binding protein(1-181)

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for RBP4 in ?

Tested Applications

Positive WB detected inhuman blood, HepG2 cells, human plasma
Positive IP detected inHepG2 cells
Positive IHC detected inmouse eye tissue, human liver cancer tissue, mouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse eye tissue, mouse kidney tissue
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:187-1:750
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11774-1-AP targets RBP4 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, camelus bactrianus, geese
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2448

Product name: Recombinant human RBP4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-201 aa of BC020633

Sequence: MKWVWALFLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Predict reactive species
Full Name retinol binding protein 4, plasma
Calculated Molecular Weight 201 aa, 23 kDa
Observed Molecular Weight 23 kDa
GenBank Accession NumberBC020633
Gene Symbol RBP4
Gene ID (NCBI) 5950
RRIDAB_2252700
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP02753
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RBP4 (retinol-binding protein 4) is a carrier protein that transports vitamin A (retinol) from the liver to the peripheral tissues. Synthesized primarily by hepatocytes and adipocytes as a 21 kDa non-glycosylated protein, RBP4 is secreted into the circulation as a retinol-RBP4 complex. In plasma the RBP4-retinol complex is bound to transthyretin (TRR), which prevents kidney filtration. Two truncated forms of RBP4, RBP4-L (truncated at Leu-183) and RBP4-LL (truncated at Leu-182 and Leu-183), exist by proteolytic process. RBP4-L and RBP4-LL, which do not bind TTR, are normally excreted into the urine but accumulate in the serum during renal failure. Urinary RBP4 has been reported as marker for glomerular disease. RBP4 also was identified as an adipokine that elevated in some INS-resistant states. Measurement of serum RBP4 could be used to assess the risk of INS resistance, type 2 diabetes, obesity, and cardiovascular disease. (18752671, 16034410)

Protocols

Product Specific Protocols
IF protocol for RBP4 antibody 11774-1-APDownload protocol
IHC protocol for RBP4 antibody 11774-1-APDownload protocol
IP protocol for RBP4 antibody 11774-1-APDownload protocol
WB protocol for RBP4 antibody 11774-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

RBP4 antibody (Cat# 11774-1-AP) has 28 citations across journals including Nature Communications, Metabolism, Theranostics, JCI Insight, PLoS Pathogens, and Lab Investigation. Research fields span glucose homeostasis and diabetes, retinoid/vitamin A metabolism, ocular biology, neuronal differentiation, gastric cancer, viral infection, inflammatory diseases (periodontitis, ulcerative colitis), reproductive biology, and proteomics.

SpeciesApplicationTitle
mouseWB,IF

Bioact Mater

Bio-inspired chiral self-assemblies promoted neuronal differentiation of retinal progenitor cells through activation of metabolic pathway.

Authors - Na Sun
mouseIF

Nat Commun

Metabolic adaptation drives self-organization during skin organoid morphogenesis.

Authors - Jingwei Jiang
mouseWB,IHC

Metabolism

Disruption of retinoid homeostasis induces RBP4 overproduction in diabetes: O-GlcNAcylation involved.

Authors - Shyi-Jang Shin
mouse,humanWB

Theranostics

Growth hormone receptor disrupts glucose homeostasis via promoting and stabilizing retinol binding protein 4.

Authors - Jinxin Liu
WB

J Neuroinflammation

Succinate-induced macrophage polarization and RBP4 secretion promote vascular sprouting in ocular neovascularization

Authors - Tianyi Shen
mouseWB

Phytomedicine

A novel regulatory mechanism of geniposide for improving glucose homeostasis mediated by circulating RBP4

Authors - Jinxin Liu

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer rated this antibody 4 out of 5 stars for immunohistochemistry on human cervical spinal cord tissue at a 1/100 dilution. They noted that the labeling was somewhat faded at this concentration, suggesting that a higher concentration or adjusted protocol may be needed for optimal signal intensity. Overall, the antibody performed acceptably but could show stronger staining with optimization.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Azita (Verified Customer) (05-31-2021)

Human spinal cord (cervical) tissue In 1/100 dilution gave fade labelling

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1/100
  • Cell Tissue Type: Human spinal cord (cervical) tissue
RBP4 Antibody Immunohistochemistry validation (1/100 dilution) in Human spinal cord (cervical) tissue (Cat no:11774-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...