• Featured Product
  • KD/KO Validated

S100A11 Polyclonal antibody

S100A11 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 10237-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, Neutralization, ELISA

Calgizzarin, MLN 70, MLN70, Protein S100 A11, Protein S100 C

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inDU 145 cells, HCT 116 cells, BxPC-3 cells, human lung tissue, HEK-293 cells, human heart tissue, COLO 320 cells, HaCaT cells, U2OS cells, SKOV-3 cells
Positive IP detected inDU 145 cells, PC-3 cells
Positive IHC detected inhuman breast cancer tissue, human cervical cancer tissue, human colon tissue, human colon cancer tissue, human liver cancer tissue, human lung cancer tissue, human ovary tumor tissue, human thyroid cancer tissue, mouse kidney tissue, rat kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inPC-3 cells, BxPC-3 cells
Positive FC (Intra) detected inPC-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10237-1-AP targets S100A11 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, Neutralization, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0343

Product name: Recombinant human S100A11 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 4-105 aa of BC001410

Sequence: ISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT

Predict reactive species
Full Name S100 calcium binding protein A11
Calculated Molecular Weight 105 aa, 12 kDa
Observed Molecular Weight 12 kDa
GenBank Accession NumberBC001410
Gene Symbol S100A11
Gene ID (NCBI) 6282
RRIDAB_2183478
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP31949
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

S100A11 (also known as S100C or calziggarin), is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs (PMID: 18694925). S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. First discovered in 1989, S100A11 has since been proposed to have direct biological functions in an assortment of physiological processes such as endo- and exocytosis, regulation of enzyme activity, cell growth and regulation, apoptosis and inflammation (PMID: 15241500). Chromosomal rearrangements and altered expression of S100A11 have been implicated in tumor metastasis. This S100A11 antibody (10237-1-AP) has also been instrumental in investigations into S100A11's role in the development of brain tumors in tuberous sclerosis complex (TSC) patients (PMID: 20133820).

Protocols

Product Specific Protocols
FC protocol for S100A11 antibody 10237-1-APDownload protocol
IF protocol for S100A11 antibody 10237-1-APDownload protocol
IHC protocol for S100A11 antibody 10237-1-APDownload protocol
IP protocol for S100A11 antibody 10237-1-APDownload protocol
WB protocol for S100A11 antibody 10237-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IF

Nat Commun

S100A11 is required for efficient plasma membrane repair and survival of invasive cancer cells.

Authors - Jyoti K Jaiswal
humanWB

Dev Cell

Annexin A1 Tethers Membrane Contact Sites that Mediate ER to Endosome Cholesterol Transport.

Authors - Emily R Eden
humanIHC

J Pathol

Tissue-based proteomics reveals FXYD3, S100A11 and GSTM3 as novel markers for regional lymph node metastasis in colon cancer.

Authors - Meding Stephan S
humanIF

Mol Cell Proteomics

S100A11 mediates hypoxia-induced mitogenic factor (HIMF)-induced smooth muscle cell migration, vesicular exocytosis, and nuclear activation.

Authors - Fan Chunling C
humanWB,IF,CoIP

Cell Mol Gastroenterol Hepatol

S100A11 Promotes Liver Steatosis via FOXO1-Mediated Autophagy and Lipogenesis.

Authors - Linqiang Zhang
mouse,humanWB,IHC,IF

J Clin Endocrinol Metab

Down-regulation of S100A11, a calcium-binding protein, in human endometrium may cause reproductive failure.

Authors - Liu Xin-Mei XM
Loading...
||
New chat

Able

正在加载,请稍候...