S100A11 Polyclonal antibody, PBS Only

• 

  WB analysis using 10237-1-AP (same clone as 10237-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10237-1-AP (S100A11 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 cells using 10237-1-AP (same clone as 10237-1-PBS)

  WB result of S100A11 antibody (10237-1-AP, 1:4000) with si-control and si-S100A11 transfected PC-3 cells. This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 10237-1-AP (same clone as 10237-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10237-1-AP (S100A11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 10237-1-AP (same clone as 10237-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10237-1-AP (S100A11 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 10237-1-AP (same clone as 10237-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 10237-1-AP (S100A11 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human lung using 10237-1-AP (same clone as 10237-1-PBS)

  human lung tissue were subjected to SDS PAGE followed by western blot with 10237-1-AP (S100A11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 10237-1-AP (same clone as 10237-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10237-1-AP (S100A11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 10237-1-AP (same clone as 10237-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 10237-1-AP (S100A11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 10237-1-AP (same clone as 10237-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 10237-1-AP (S100A11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  WB analysis of BxPC-3 using 10237-1-AP (same clone as 10237-1-PBS)

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 10237-1-AP (S100A11 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-12 using 10237-1-AP (same clone as 10237-1-PBS)

  PC-12 cells were subjected to SDS PAGE followed by western blot with 10237-1-AP (S100A11 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  IP experiment of PC-3 using 10237-1-AP (same clone as 10237-1-PBS)

  IP result of anti-S100A11 (IP:10237-1-AP, 3ug; Detection:10237-1-AP 1:1000) with PC-3 cells lysate 1000ug. This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  IP experiment of DU 145 using 10237-1-AP (same clone as 10237-1-PBS)

  IP result of anti-S100A11 (IP:10237-1-AP, 4ug; Detection:10237-1-AP 1:5000) with DU 145 cells lysate 1280 ug. This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 10237-1-AP (same clone as 10237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10237-1-AP (S100A11 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 10237-1-AP (same clone as 10237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 10237-1-AP (S100A11 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 10237-1-AP (same clone as 10237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10237-1-AP (S100A11 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human thyroid cancer using 10237-1-AP (same clone as 10237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 10237-1-AP (S100A11 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 10237-1-AP (same clone as 10237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 10237-1-AP (S100A11 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat kidney using 10237-1-AP (same clone as 10237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 10237-1-AP (S100A11 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10237-1-AP (same clone as 10237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10237-1-AP (S100A11 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10237-1-AP (same clone as 10237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10237-1-AP (S100A11 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 10237-1-AP (same clone as 10237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 10237-1-AP (S100A11 antibody) at dilution of 1:1200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 10237-1-AP (same clone as 10237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 10237-1-AP (S100A11 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 10237-1-AP (same clone as 10237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 10237-1-AP (S100A11 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 10237-1-AP (same clone as 10237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 10237-1-AP (S100A11 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 10237-1-AP (same clone as 10237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 10237-1-AP (S100A11 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 10237-1-AP (same clone as 10237-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using S100A11 antibody (10237-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  IF Staining of BxPC-3 using 10237-1-AP (same clone as 10237-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed BxPC-3 cells using S100A11 antibody (10237-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  IF Staining of BxPC-3 using 10237-1-AP (same clone as 10237-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed BxPC-3 cells using S100A11 antibody (10237-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• 

  FC experiment of PC-3 using 10237-1-AP (same clone as 10237-1-PBS)

  1x10^6 PC-3 cells were intracellularly stained with 0.8 ug S100A11 Polyclonal antibody (10237-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.8 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 10237-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

S100A11 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 10237-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

Calgizzarin, MLN 70, MLN70, Protein S100 A11, Protein S100 C

---

Product Information

10237-1-PBS targets S100A11 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0343

  Product name: Recombinant human S100A11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 4-105 aa of BC001410

  Sequence: ISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT

• Full Name: S100 calcium binding protein A11
• Calculated Molecular Weight: 105 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC001410
• Gene Symbol: S100A11
• Gene ID (NCBI): 6282
• RRID: AB_2183478
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P31949
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

S100A11 (also known as S100C or calziggarin), is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs (PMID: 18694925). S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. First discovered in 1989, S100A11 has since been proposed to have direct biological functions in an assortment of physiological processes such as endo- and exocytosis, regulation of enzyme activity, cell growth and regulation, apoptosis and inflammation (PMID: 15241500). Chromosomal rearrangements and altered expression of S100A11 have been implicated in tumor metastasis. This S100A11 antibody (10237-1-AP) has also been instrumental in investigations into S100A11's role in the development of brain tumors in tuberous sclerosis complex (TSC) patients (PMID: 20133820).