• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated S100A11 Polyclonal antibody

S100A11 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-10237

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Protein S100-A11, Protein S100 C, Protein S100 A11, MLN70, MLN 70

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inPC-3 cells
Positive FC (Intra) detected inPC-3 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10237 targets S100A11 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0343

Product name: Recombinant human S100A11 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 3-105 aa of BC001410

Sequence: KISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT

Predict reactive species
Full Name S100 calcium binding protein A11
Calculated Molecular Weight 105 aa, 12 kDa
GenBank Accession NumberBC001410
Gene Symbol S100A11
Gene ID (NCBI) 6282
RRIDAB_2918965
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP31949
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

S100A11 (also known as S100C or calziggarin), is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs (PMID: 18694925). S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. First discovered in 1989, S100A11 has since been proposed to have direct biological functions in an assortment of physiological processes such as endo- and exocytosis, regulation of enzyme activity, cell growth and regulation, apoptosis and inflammation (PMID: 15241500). Chromosomal rearrangements and altered expression of S100A11 have been implicated in tumor metastasis. This S100A11 antibody (10237-1-AP) has also been instrumental in investigations into S100A11's role in the development of brain tumors in tuberous sclerosis complex (TSC) patients (PMID: 20133820).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 S100A11 antibody CL488-10237Download protocol
IF protocol for CL Plus 488 S100A11 antibody CL488-10237Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...