SCRIB Polyclonal antibody

SCRIB Polyclonal Antibody for WB, IHC, ELISA
Cat No. 27083-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

CRIB1, hScrib, KIAA0147, LAP4, Protein LAP4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNIH/3T3 cells
Positive IHC detected inhuman ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27083-1-AP targets SCRIB in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25795

Product name: Recombinant human SCRIB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1331-1630 aa of BC036905

Sequence: HPPEDAPAQPPTPGPAASPEQLSFRERQKYFELEVRVPQAEGPPKRVSLVGADDLRKMQEEEARKLQQKRAQMLREAAEAGAEARLALDGETLGEEEQEDEQPPWASPSPTSRQSPASPPPLGGGAPVRTAKAERRHQERLRVQSPEPPAPERALSPAELRALEAEKRALWRAARMKSLEQDALRAQMVLSRSQEGRGTRGPLERLAEAPSPAPTPSPTPVEDLGPQTSTSPGRLSPDFAEELRSLEPSPSPGPQEEDGEVALVLLGRPSPGAVGPEDVALCSSRRPVRPGRRGLGPVPS

Predict reactive species
Full Name scribbled homolog (Drosophila)
Calculated Molecular Weight 1630 aa, 175 kDa
Observed Molecular Weight 260 kDa
GenBank Accession NumberBC036905
Gene Symbol SCRIB
Gene ID (NCBI) 23513
RRIDAB_2880749
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ14160
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SCRIB encodes a large, 260-kDa cytoplasmic scaffolding protein that comprises a large leucine-rich repeat (LRR) region and 4 PDZ domains that regulate protein-protein interactions. In mammals, cell polarity is established and maintained by at least 3 protein modules (Scrib, Crumbs, and Par). The apical (Crumbs and Par) and basolateral (Scrib) modules function in a mutually antagonistic relationship to regulate various polarization processes such as apical-basal polarity, planar cell polarity, asymmetric cell division and migration. The loss of SCRIB in malignant tumors suggest that it has potential to be a tumor suppressor. Alteration of polarity through deletion, downregulation, overexpression, and mislocalization can induce structural and functional alteration of cells that might be related to tumorigenesis. Mislocalization of SCRIB is involved in epithelial-to-mesenchymal transition (EMT) by inducing loss of E-cadherin. Deregulated SCRIB expression induces tumorigenesis in breast and liver. (PMID: 28460446, PMID: 32564009)

Protocols

Product Specific Protocols
IHC protocol for SCRIB antibody 27083-1-APDownload protocol
WB protocol for SCRIB antibody 27083-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Oxid Med Cell Longev

MiR-9-5p Inhibits the MMP+-Induced Neuron Apoptosis through Regulating SCRIB/β-Catenin Signaling in Parkinson's Disease.

Authors - Zhenyong Xiao
mouseWB,IF

Life Sci Alliance

SLMAP3 is essential for neurulation through mechanisms involving cytoskeletal elements, ABP, and PCP

Authors - Taha Rehmani

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Sammy (Verified Customer) (06-20-2024)

Excellent for detection of Scribble by WB in endothelial cells

  • Applications: Western Blot
  • Primary Antibody Dilution: 1 in 1000
  • Cell Tissue Type: HUVEC
Loading...
||
New chat Able
正在加载,请稍候...