Tested Applications
| Positive WB detected in | EC109 cells, HEK-293 cells, DC2.4 cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11147-2-AP targets SEC61G in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1624 Product name: Recombinant human SEC61G protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC009480 Sequence: MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG Predict reactive species |
| Full Name | Sec61 gamma subunit |
| Calculated Molecular Weight | 7.7 kDa |
| Observed Molecular Weight | 7.7 kDa |
| GenBank Accession Number | BC009480 |
| Gene Symbol | SEC61G |
| Gene ID (NCBI) | 23480 |
| RRID | AB_2254450 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P60059 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SEC61G is a subunit of the SEC61 complex, which also contains alpha (SEC61A) and beta (SEC61B) subunits. The SEC61 complex is the central component of the protein translocation apparatus on the endoplasmic reticulum membrane. The gene of SEC61G maps to chromosome 7p11.2, and encodes a 68-amino acid single-pass membrane protein. This antibody can recognize endogenous SEC61G that migrates at a molecular mass of ~8 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SEC61G antibody 11147-2-AP | Download protocol |
| WB protocol for SEC61G antibody 11147-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The antibody 11147-2-AP targets SEC61G and has 25 total citations. Publications span high-impact journals including Nature, Immunity, Cancer Research, PNAS, Cell Death & Disease, British Journal of Cancer, BMC Cancer, eLife, and others. Research fields cover cancer biology (lung, breast, colorectal, gastric, head and neck, kidney, and liver cancers), endoplasmic reticulum stress, protein translocation, autophagy, immunology (cross-presentation), and neurobiology. Applications include WB, IHC, IF, IP, and CoIP.
| Species | Application | Title |
|---|---|---|
Immunity The translocon protein sec61 mediates antigen transport from endosomes in the cytosol for cross-presentation to CD8(+) T cells.
| ||
Cancer Res Glioblastoma proto-oncogene SEC61gamma is required for tumor cell survival and response to endoplasmic reticulum stress.
| ||
Neuro Oncol The deadly connection between endoplasmic reticulum, Ca2+, protein synthesis, and the endoplasmic reticulum stress response in malignant glioma cells. | ||
Cell Death Dis SEC61G promotes breast cancer development and metastasis via modulating glycolysis and is transcriptionally regulated by E2F1.
| ||
Proc Natl Acad Sci U S A A scalable strategy for high-throughput GFP tagging of endogenous human proteins. |
