• Featured Product
  • KD/KO Validated

SIRT3 Polyclonal antibody

SIRT3 Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 10099-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF, IP, CoIP, ELISA

EC:2.3.1.286, hSIRT3, NAD-dependent protein deacetylase sirtuin-3, mitochondrial, Regulatory protein SIR2 homolog 3, SIR2 like protein 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHT-29 cells, mouse heart tissue, human spleen tissue, mouse kidney tissue, mouse skeletal muscle tissue, rat heart tissue, HEK-293 cells, HepG2 cells, mouse liver tissue, rat liver tissue
Positive IP detected inHT-29 cells
Positive IHC detected inhuman stomach tissue, human intrahepatic cholangiocarcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10099-1-AP targets SIRT3 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, chicken, bovine, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0148

Product name: Recombinant human SIRT3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 202-399 aa of BC001042

Sequence: GNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK

Predict reactive species
Full Name sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae)
Calculated Molecular Weight 44 kDa
Observed Molecular Weight 28 kDa
GenBank Accession NumberBC001042
Gene Symbol SIRT3
Gene ID (NCBI) 23410
RRIDAB_2239240
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NTG7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sirtuins are NAD+-dependent histone/protein deacetylases (HDAC) and SIRT3 is the only sirtuin whose increased expression has been shown to correlate with an extended life span in humans. It is localized in the mitochondrial matrix, where it regulates the acetylation levels of metabolic enzymes, including acetyl coenzyme A synthetase 2. SIRT3 is stress-responsive and its increased expression protects myocytes from genotoxic and oxidative stress-mediated cell death. full-length hSIRT3 (44 kDa) is an inert protein and that it is activated inside the mitochondria following deletion of 142 amino acids of the N-terminal segment. This processed form of SIRT3 is approximately 28 kDa and possesses deacetylase activity. The full SIRT3 is a 44 kDa protein and is processed by mitochondrial processing peptidase (MPP) to give a 28 kDa product.

Protocols

Product Specific Protocols
IHC protocol for SIRT3 antibody 10099-1-APDownload protocol
IP protocol for SIRT3 antibody 10099-1-APDownload protocol
WB protocol for SIRT3 antibody 10099-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Cell Metab

Elevation of JAML Promotes Diabetic Kidney Disease by Modulating Podocyte Lipid Metabolism.

Authors - Yi Fu
mouseWB

Nat Commun

Sirt6 deficiency exacerbates podocyte injury and proteinuria through targeting Notch signaling.

Authors - Min Liu
humanWB

Nat Commun

Cordycepin prevents radiation ulcer by inhibiting cell senescence via NRF2 and AMPK in rodents.

Authors - Ziwen Wang
mouseWB,CoIP

Redox Biol

Adiponectin/AdiopR1 signaling prevents mitochondrial dysfunction and oxidative injury after traumatic brain injury in a SIRT3 dependent manner.

Authors - Shenghao Zhang
mouseWB

Cell Death Dis

Metformin improves HPRT1-targeted purine metabolism and repairs NR4A1-mediated autophagic flux by modulating FoxO1 nucleocytoplasmic shuttling to treat postmenopausal osteoporosis

Authors - Keda Yang
humanWB,IF

Cell Death Dis

HAT1/HDAC2 mediated ACSL4 acetylation confers radiosensitivity by inducing ferroptosis in nasopharyngeal carcinoma

Authors - Peijun Zhou

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Tanusree (Verified Customer) (12-18-2019)

Product worked well in WB at 1:500 dilution

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Mouse brain
Loading...
||
New chat Able
正在加载,请稍候...