SMARCA4/BRG1 Recombinant monoclonal antibody

SMARCA4/BRG1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA
Cat No. 83310-2-RR
Clone No.240172F4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

SMARCA4, 240172F4, ATP dependent helicase SMARCA4, ATP-dependent helicase SMARCA4, BAF190

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, HSC-T6 cells, NIH/3T3 cells, HEK-293T cells, C6 cells
Positive IHC detected inhuman tonsillitis tissue, human placenta tissue, mouse cerebellum tissue, mouse colon tissue, mouse lung tissue, rat cerebellum tissue, rat colon tissue, rat lung tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:125-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83310-2-RR targets SMARCA4/BRG1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag16256

Product name: Recombinant human SMARCA4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 207-298 aa of BC150298

Sequence: KRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTST

Predict reactive species
Full Name SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
Calculated Molecular Weight 1647 aa, 185 kDa
Observed Molecular Weight 185 kDa
GenBank Accession NumberBC150298
Gene Symbol SMARCA4
Gene ID (NCBI) 6597
RRIDAB_3670976
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP51532
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SMARCA4, also named as BAF190A, BRG1, SNF2B and SNF2L4, belongs to the SNF2/RAD54 helicase family. SMARCA4 is a transcriptional coactivator cooperating with nuclear hormone receptors to potentiate transcriptional activation. It is a component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. It is also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene.

Protocols

Product Specific Protocols
FC protocol for SMARCA4/BRG1 antibody 83310-2-RRDownload protocol
IF protocol for SMARCA4/BRG1 antibody 83310-2-RRDownload protocol
IHC protocol for SMARCA4/BRG1 antibody 83310-2-RRDownload protocol
WB protocol for SMARCA4/BRG1 antibody 83310-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...